GBREL.TXT Genetic Sequence Data Bank April 15 2026 NCBI-GenBank Flat File Release 271.0 Distribution Release Notes 261460182 sequences, 7289942983522 bases, for traditional GenBank records 6006534948 sequences, 46606326267767 bases, for set-based (WGS/TSA/TLS) records This document describes the format and content of the flat files that comprise releases of the GenBank nucleotide sequence database. If you have any questions or comments about GenBank or this document, please contact NCBI via email at info@ncbi.nlm.nih.gov or: GenBank National Center for Biotechnology Information National Library of Medicine, 38A, 8N805 8600 Rockville Pike Bethesda, MD 20894 USA GenBank releases do not include sequence records that originate from third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project. Rather, GenBank is the archival/primary resource which those other efforts draw upon. For information about TPA and RefSeq, please visit: http://www.ncbi.nih.gov/Genbank/TPA.html http://www.ncbi.nlm.nih.gov/RefSeq ========================================================================== TABLE OF CONTENTS ========================================================================== 1. INTRODUCTION 1.1 Release 271.0 1.2 Cutoff Date 1.3 Important Changes in Release 271.0 1.4 Upcoming Changes 1.5 Request for Direct Submission of Sequence Data 1.6 Organization of This Document 2. ORGANIZATION OF DATA FILES 2.1 Overview 2.2 Files 2.2.1 File Descriptions 2.2.5 File Sizes 2.2.6 Per-Division Statistics 2.2.7 Selected Per-Organism Statistics 2.2.8 Growth of GenBank 3. FILE FORMATS 3.1 File Header Information 3.4 Sequence Entry Files 3.4.1 File Organization 3.4.2 Entry Organization 3.4.3 Sample Sequence Data File 3.4.4 LOCUS Format 3.4.5 DEFINITION Format 3.4.5.1 DEFINITION Format for NLM Entries 3.4.6 ACCESSION Format 3.4.7 VERSION Format 3.4.8 KEYWORDS Format 3.4.9 SEGMENT Format 3.4.10 SOURCE Format 3.4.11 REFERENCE Format 3.4.12 FEATURES Format 3.4.12.1 Feature Key Names 3.4.12.2 Feature Location 3.4.12.3 Feature Qualifiers 3.4.12.4 Cross-Reference Information 3.4.12.5 Feature Table Examples 3.4.13 ORIGIN Format 3.4.14 SEQUENCE Format 3.4.15 CONTIG Format 4. ALTERNATE RELEASES 5. KNOWN PROBLEMS OF THE GENBANK DATABASE 5.1 Incorrect Gene Symbols in Entries 6. GENBANK ADMINISTRATION 6.1 Registered Trademark Notice 6.2 Citing GenBank 6.3 GenBank Distribution Formats and Media 6.4 Other Methods of Accessing GenBank Data 6.5 Request for Corrections and Comments 6.6 Credits and Acknowledgments 6.7 Disclaimer ========================================================================== 1. INTRODUCTION 1.1 Release 271.0 The National Center for Biotechnology Information (NCBI) at the National Library of Medicine (NLM), National Institutes of Health (NIH) is responsible for producing and distributing the GenBank Sequence Database. NCBI handles all GenBank direct submissions and authors are advised to use the address below. Submitters are encouraged to use Submission Portal or BankIt for sending sequence data. ***************************************************************************** The address for direct submissions to GenBank is: GenBank Submissions National Center for Biotechnology Information Bldg 38A, Rm. 8N-803 8600 Rockville Pike Bethesda, MD 20894 Email: gb-sub@ncbi.nlm.nih.gov Updates and changes to existing GenBank records: https://www.ncbi.nlm.nih.gov/genbank/update/ Email: update@ncbi.nlm.nih.gov URLs for GenBank's web-based submission tools: Submission Portal https://submit.ncbi.nlm.nih.gov/ BankIt https://www.ncbi.nlm.nih.gov/WebSub/ See Section 1.5 for additional details about submitting data to GenBank. ***************************************************************************** GenBank Release 271.0 is a release of sequence data by NCBI in the GenBank Flatfile format. GenBank is a component of a tri-partite collaboration of sequence databases in the U.S., Europe, and Japan, known as the International Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are incorporated through arrangements with the U.S. Patent and Trademark Office, and via the collaborating international databases from other international patent offices. The database is converted to various output formats, including the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1 and Flatfile forms of the data are available at NCBI's anonymous FTP server : https://ftp.ncbi.nih.gov/ncbi-asn1 https://ftp.ncbi.nih.gov/genbank GenBank releases do not contain sequence records that originate from unfinished Whole Genome Shotgun (WGS) genome sequencing projects, Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from Targeted Locus Study (TLS) sequencing projects. The sequence data from those efforts are made available separately, on a per-project basis: https://ftp.ncbi.nih.gov/genbank/wgs https://ftp.ncbi.nih.gov/ncbi-asn1/wgs https://ftp.ncbi.nih.gov/genbank/tsa https://ftp.ncbi.nih.gov/ncbi-asn1/tsa https://ftp.ncbi.nih.gov/genbank/tls https://ftp.ncbi.nih.gov/ncbi-asn1/tls See the README files in those areas for more information. 1.2 Cutoff Date This full release, 271.0, incorporates data processed by the INSDC databases as of Monday April 6 2026 at 7:17 PM EDT. For more recent data, users are advised to: o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI: https://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format) https://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format) o Use the interactive Network-Entrez or Web-Entrez applications to query the 'Entrez: Nucleotide' database (see Section 6.4 of this document). 1.3 Important Changes in Release 271.0 1.3.1 Organizational changes The total number of sequence data files for traditional GenBank records (non-WGS/TSA/TLS) increased by 274 with this release: - the BCT division is now composed of 503 files (+3) - the ENV division is now composed of 41 files (+1) - the INV division is now composed of 2306 files (+174) - the MAM division is now composed of 235 files (+3) - the PLN division is now composed of 3015 files (+54) - the ROD division is now composed of 127 files (+7) - the VRL division is now composed of 345 files (+1) - the VRT division is now composed of 580 files (+25) 1.4 Upcoming Changes 1.4.1 GenBank will discontinue base quality score file distribution from October 2026 GenBank previously accepted base quality scores associated with older ABI sequencing technologies. With the widespread adoption of newer sequencing methodologies, GenBank is no longer receiving new quality score data as part of sequence submissions. Therefore, the following base quality score files will be discontinued and no longer distributed in October 2026. GenBank Incremental Updates: quality score files will no longer be posted in https://ftp.ncbi.nlm.nih.gov/genbank/daily-nc/ GenBank Release: quality score files at the following location will be discontinued: https://ftp.ncbi.nlm.nih.gov/genbank/quality_scores/ 1.4.2 The MEDLINE line no longer exists and is obsolete. Citations in PubMed that do not fall within Medline's scope will have only a PUBMED identifier. Similarly, citations that *are* in Medline's scope but which have not yet been assigned Medline UIs will have only a PUBMED identifier. If a citation is present in both the PubMed and Medline databases, both a MEDLINE and a PUBMED line will be present. 1.4.3 Addition of organelle Nitroplast Upcoming addition of organelle Nitroplast will become legal in June 2026 with the release of the INSDC Feature Table Version 11.4/organelle-"nitroplast" https://dev.insdc.org/submitting-standards/feature-table/ 1.5 Request for Direct Submission of Sequence Data A successful GenBank requires that sequence data enter the database as soon as possible after publication, that the annotations be as complete as possible, and that the sequence and annotation data be accurate. All three of these requirements are best met if authors of sequence data submit their data directly to GenBank utilizing the tools summarized below. GenBank must rely on direct author submission of data to ensure that it achieves its goals of completeness, accuracy, and timeliness. General information for submitting to Genbank is available online: https://www.ncbi.nlm.nih.gov/genbank/submit/ To assist researchers in entering their own sequence data, GenBank provides Web-based submission tools: Submission Portal and Bankit. Submission Portal https://submit.ncbi.nlm.nih.gov/ BankIt https://www.ncbi.nlm.nih.gov/WebSub/ Submission Portal provides an efficient submission pathway for high frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1, SARS-CoV-2, etc.). BankIt is an easy-to-use program that enables authors to enter one or more sequences, annotate, and submit to GenBank. BankIt provides a simple forms-based approach for submitting your sequence and the relevant associated metadata to GenBank. Genbank also provides submission preparation tools which require uploading via the Submission Portal or email to gb-sub@ncbi.nlm.nih.gov when relevant: table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/ table2asn is a command-line program that automates the creation of sequence records for submission to GenBank. It is used primarily for submission of complete genomes and large batches of sequences and is available by FTP for use on MAC, PC and Unix platforms: https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/ Through the international collaboration of DNA sequence databases, GenBank submissions are forwarded daily for inclusion in the European Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ). If you have questions about GenBank submissions or any of the data submission tools, contact NCBI at: info@ncbi.nlm.nih.gov . 1.6 Organization of This Document The second section describes the contents of GenBank releases. The third section illustrates the formats of the flat files. The fourth section describes other versions of the data, the fifth section identifies known prob- lems, and the sixth contains administrative details. 2. ORGANIZATION OF DATA FILES 2.1 Overview GenBank releases consist of a set of ASCII text files, most of which contain sequence data. A few supplemental files are also supplied, containing lists of new, modified, and deleted sequence records. The line-lengths of these files is variable. 2.2 Files This GenBank flat file release consists of 7665 files. The lists that follow describe each of the files included in the distribution. Their sizes and base pair content are also summarized. 2.2.1 File Descriptions Files included in this release are: 1. gbbct1.seq - Bacterial sequence entries, part 1. 2. gbbct10.seq - Bacterial sequence entries, part 10. 3. gbbct100.seq - Bacterial sequence entries, part 100. 4. gbbct101.seq - Bacterial sequence entries, part 101. 5. gbbct102.seq - Bacterial sequence entries, part 102. 6. gbbct103.seq - Bacterial sequence entries, part 103. 7. gbbct104.seq - Bacterial sequence entries, part 104. 8. gbbct105.seq - Bacterial sequence entries, part 105. 9. gbbct106.seq - Bacterial sequence entries, part 106. 10. gbbct107.seq - Bacterial sequence entries, part 107. 11. gbbct108.seq - Bacterial sequence entries, part 108. 12. gbbct109.seq - Bacterial sequence entries, part 109. 13. gbbct11.seq - Bacterial sequence entries, part 11. 14. gbbct110.seq - Bacterial sequence entries, part 110. 15. gbbct111.seq - Bacterial sequence entries, part 111. 16. gbbct112.seq - Bacterial sequence entries, part 112. 17. gbbct113.seq - Bacterial sequence entries, part 113. 18. gbbct114.seq - Bacterial sequence entries, part 114. 19. gbbct115.seq - Bacterial sequence entries, part 115. 20. gbbct116.seq - Bacterial sequence entries, part 116. 21. gbbct117.seq - Bacterial sequence entries, part 117. 22. gbbct118.seq - Bacterial sequence entries, part 118. 23. gbbct119.seq - Bacterial sequence entries, part 119. 24. gbbct12.seq - Bacterial sequence entries, part 12. 25. gbbct120.seq - Bacterial sequence entries, part 120. 26. gbbct121.seq - Bacterial sequence entries, part 121. 27. gbbct122.seq - Bacterial sequence entries, part 122. 28. gbbct123.seq - Bacterial sequence entries, part 123. 29. gbbct124.seq - Bacterial sequence entries, part 124. 30. gbbct125.seq - Bacterial sequence entries, part 125. 31. gbbct126.seq - Bacterial sequence entries, part 126. 32. gbbct127.seq - Bacterial sequence entries, part 127. 33. gbbct128.seq - Bacterial sequence entries, part 128. 34. gbbct129.seq - Bacterial sequence entries, part 129. 35. gbbct13.seq - Bacterial sequence entries, part 13. 36. gbbct130.seq - Bacterial sequence entries, part 130. 37. gbbct131.seq - Bacterial sequence entries, part 131. 38. gbbct132.seq - Bacterial sequence entries, part 132. 39. gbbct133.seq - Bacterial sequence entries, part 133. 40. gbbct134.seq - Bacterial sequence entries, part 134. 41. gbbct135.seq - Bacterial sequence entries, part 135. 42. gbbct136.seq - Bacterial sequence entries, part 136. 43. gbbct137.seq - Bacterial sequence entries, part 137. 44. gbbct138.seq - Bacterial sequence entries, part 138. 45. gbbct139.seq - Bacterial sequence entries, part 139. 46. gbbct14.seq - Bacterial sequence entries, part 14. 47. gbbct140.seq - Bacterial sequence entries, part 140. 48. gbbct141.seq - Bacterial sequence entries, part 141. 49. gbbct142.seq - Bacterial sequence entries, part 142. 50. gbbct143.seq - Bacterial sequence entries, part 143. 51. gbbct144.seq - Bacterial sequence entries, part 144. 52. gbbct145.seq - Bacterial sequence entries, part 145. 53. gbbct146.seq - Bacterial sequence entries, part 146. 54. gbbct147.seq - Bacterial sequence entries, part 147. 55. gbbct148.seq - Bacterial sequence entries, part 148. 56. gbbct149.seq - Bacterial sequence entries, part 149. 57. gbbct15.seq - Bacterial sequence entries, part 15. 58. gbbct150.seq - Bacterial sequence entries, part 150. 59. gbbct151.seq - Bacterial sequence entries, part 151. 60. gbbct152.seq - Bacterial sequence entries, part 152. 61. gbbct153.seq - Bacterial sequence entries, part 153. 62. gbbct154.seq - Bacterial sequence entries, part 154. 63. gbbct155.seq - Bacterial sequence entries, part 155. 64. gbbct156.seq - Bacterial sequence entries, part 156. 65. gbbct157.seq - Bacterial sequence entries, part 157. 66. gbbct158.seq - Bacterial sequence entries, part 158. 67. gbbct159.seq - Bacterial sequence entries, part 159. 68. gbbct16.seq - Bacterial sequence entries, part 16. 69. gbbct160.seq - Bacterial sequence entries, part 160. 70. gbbct161.seq - Bacterial sequence entries, part 161. 71. gbbct162.seq - Bacterial sequence entries, part 162. 72. gbbct163.seq - Bacterial sequence entries, part 163. 73. gbbct164.seq - Bacterial sequence entries, part 164. 74. gbbct165.seq - Bacterial sequence entries, part 165. 75. gbbct166.seq - Bacterial sequence entries, part 166. 76. gbbct167.seq - Bacterial sequence entries, part 167. 77. gbbct168.seq - Bacterial sequence entries, part 168. 78. gbbct169.seq - Bacterial sequence entries, part 169. 79. gbbct17.seq - Bacterial sequence entries, part 17. 80. gbbct170.seq - Bacterial sequence entries, part 170. 81. gbbct171.seq - Bacterial sequence entries, part 171. 82. gbbct172.seq - Bacterial sequence entries, part 172. 83. gbbct173.seq - Bacterial sequence entries, part 173. 84. gbbct174.seq - Bacterial sequence entries, part 174. 85. gbbct175.seq - Bacterial sequence entries, part 175. 86. gbbct176.seq - Bacterial sequence entries, part 176. 87. gbbct177.seq - Bacterial sequence entries, part 177. 88. gbbct178.seq - Bacterial sequence entries, part 178. 89. gbbct179.seq - Bacterial sequence entries, part 179. 90. gbbct18.seq - Bacterial sequence entries, part 18. 91. gbbct180.seq - Bacterial sequence entries, part 180. 92. gbbct181.seq - Bacterial sequence entries, part 181. 93. gbbct182.seq - Bacterial sequence entries, part 182. 94. gbbct183.seq - Bacterial sequence entries, part 183. 95. gbbct184.seq - Bacterial sequence entries, part 184. 96. gbbct185.seq - Bacterial sequence entries, part 185. 97. gbbct186.seq - Bacterial sequence entries, part 186. 98. gbbct187.seq - Bacterial sequence entries, part 187. 99. gbbct188.seq - Bacterial sequence entries, part 188. 100. gbbct189.seq - Bacterial sequence entries, part 189. 101. gbbct19.seq - Bacterial sequence entries, part 19. 102. gbbct190.seq - Bacterial sequence entries, part 190. 103. gbbct191.seq - Bacterial sequence entries, part 191. 104. gbbct192.seq - Bacterial sequence entries, part 192. 105. gbbct193.seq - Bacterial sequence entries, part 193. 106. gbbct194.seq - Bacterial sequence entries, part 194. 107. gbbct195.seq - Bacterial sequence entries, part 195. 108. gbbct196.seq - Bacterial sequence entries, part 196. 109. gbbct197.seq - Bacterial sequence entries, part 197. 110. gbbct198.seq - Bacterial sequence entries, part 198. 111. gbbct199.seq - Bacterial sequence entries, part 199. 112. gbbct2.seq - Bacterial sequence entries, part 2. 113. gbbct20.seq - Bacterial sequence entries, part 20. 114. gbbct200.seq - Bacterial sequence entries, part 200. 115. gbbct201.seq - Bacterial sequence entries, part 201. 116. gbbct202.seq - Bacterial sequence entries, part 202. 117. gbbct203.seq - Bacterial sequence entries, part 203. 118. gbbct204.seq - Bacterial sequence entries, part 204. 119. gbbct205.seq - Bacterial sequence entries, part 205. 120. gbbct206.seq - Bacterial sequence entries, part 206. 121. gbbct207.seq - Bacterial sequence entries, part 207. 122. gbbct208.seq - Bacterial sequence entries, part 208. 123. gbbct209.seq - Bacterial sequence entries, part 209. 124. gbbct21.seq - Bacterial sequence entries, part 21. 125. gbbct210.seq - Bacterial sequence entries, part 210. 126. gbbct211.seq - Bacterial sequence entries, part 211. 127. gbbct212.seq - Bacterial sequence entries, part 212. 128. gbbct213.seq - Bacterial sequence entries, part 213. 129. gbbct214.seq - Bacterial sequence entries, part 214. 130. gbbct215.seq - Bacterial sequence entries, part 215. 131. gbbct216.seq - Bacterial sequence entries, part 216. 132. gbbct217.seq - Bacterial sequence entries, part 217. 133. gbbct218.seq - Bacterial sequence entries, part 218. 134. gbbct219.seq - Bacterial sequence entries, part 219. 135. gbbct22.seq - Bacterial sequence entries, part 22. 136. gbbct220.seq - Bacterial sequence entries, part 220. 137. gbbct221.seq - Bacterial sequence entries, part 221. 138. gbbct222.seq - Bacterial sequence entries, part 222. 139. gbbct223.seq - Bacterial sequence entries, part 223. 140. gbbct224.seq - Bacterial sequence entries, part 224. 141. gbbct225.seq - Bacterial sequence entries, part 225. 142. gbbct226.seq - Bacterial sequence entries, part 226. 143. gbbct227.seq - Bacterial sequence entries, part 227. 144. gbbct228.seq - Bacterial sequence entries, part 228. 145. gbbct229.seq - Bacterial sequence entries, part 229. 146. gbbct23.seq - Bacterial sequence entries, part 23. 147. gbbct230.seq - Bacterial sequence entries, part 230. 148. gbbct231.seq - Bacterial sequence entries, part 231. 149. gbbct232.seq - Bacterial sequence entries, part 232. 150. gbbct233.seq - Bacterial sequence entries, part 233. 151. gbbct234.seq - Bacterial sequence entries, part 234. 152. gbbct235.seq - Bacterial sequence entries, part 235. 153. gbbct236.seq - Bacterial sequence entries, part 236. 154. gbbct237.seq - Bacterial sequence entries, part 237. 155. gbbct238.seq - Bacterial sequence entries, part 238. 156. gbbct239.seq - Bacterial sequence entries, part 239. 157. gbbct24.seq - Bacterial sequence entries, part 24. 158. gbbct240.seq - Bacterial sequence entries, part 240. 159. gbbct241.seq - Bacterial sequence entries, part 241. 160. gbbct242.seq - Bacterial sequence entries, part 242. 161. gbbct243.seq - Bacterial sequence entries, part 243. 162. gbbct244.seq - Bacterial sequence entries, part 244. 163. gbbct245.seq - Bacterial sequence entries, part 245. 164. gbbct246.seq - Bacterial sequence entries, part 246. 165. gbbct247.seq - Bacterial sequence entries, part 247. 166. gbbct248.seq - Bacterial sequence entries, part 248. 167. gbbct249.seq - Bacterial sequence entries, part 249. 168. gbbct25.seq - Bacterial sequence entries, part 25. 169. gbbct250.seq - Bacterial sequence entries, part 250. 170. gbbct251.seq - Bacterial sequence entries, part 251. 171. gbbct252.seq - Bacterial sequence entries, part 252. 172. gbbct253.seq - Bacterial sequence entries, part 253. 173. gbbct254.seq - Bacterial sequence entries, part 254. 174. gbbct255.seq - Bacterial sequence entries, part 255. 175. gbbct256.seq - Bacterial sequence entries, part 256. 176. gbbct257.seq - Bacterial sequence entries, part 257. 177. gbbct258.seq - Bacterial sequence entries, part 258. 178. gbbct259.seq - Bacterial sequence entries, part 259. 179. gbbct26.seq - Bacterial sequence entries, part 26. 180. gbbct260.seq - Bacterial sequence entries, part 260. 181. gbbct261.seq - Bacterial sequence entries, part 261. 182. gbbct262.seq - Bacterial sequence entries, part 262. 183. gbbct263.seq - Bacterial sequence entries, part 263. 184. gbbct264.seq - Bacterial sequence entries, part 264. 185. gbbct265.seq - Bacterial sequence entries, part 265. 186. gbbct266.seq - Bacterial sequence entries, part 266. 187. gbbct267.seq - Bacterial sequence entries, part 267. 188. gbbct268.seq - Bacterial sequence entries, part 268. 189. gbbct269.seq - Bacterial sequence entries, part 269. 190. gbbct27.seq - Bacterial sequence entries, part 27. 191. gbbct270.seq - Bacterial sequence entries, part 270. 192. gbbct271.seq - Bacterial sequence entries, part 271. 193. gbbct272.seq - Bacterial sequence entries, part 272. 194. gbbct273.seq - Bacterial sequence entries, part 273. 195. gbbct274.seq - Bacterial sequence entries, part 274. 196. gbbct275.seq - Bacterial sequence entries, part 275. 197. gbbct276.seq - Bacterial sequence entries, part 276. 198. gbbct277.seq - Bacterial sequence entries, part 277. 199. gbbct278.seq - Bacterial sequence entries, part 278. 200. gbbct279.seq - Bacterial sequence entries, part 279. 201. gbbct28.seq - Bacterial sequence entries, part 28. 202. gbbct280.seq - Bacterial sequence entries, part 280. 203. gbbct281.seq - Bacterial sequence entries, part 281. 204. gbbct282.seq - Bacterial sequence entries, part 282. 205. gbbct283.seq - Bacterial sequence entries, part 283. 206. gbbct284.seq - Bacterial sequence entries, part 284. 207. gbbct285.seq - Bacterial sequence entries, part 285. 208. gbbct286.seq - Bacterial sequence entries, part 286. 209. gbbct287.seq - Bacterial sequence entries, part 287. 210. gbbct288.seq - Bacterial sequence entries, part 288. 211. gbbct289.seq - Bacterial sequence entries, part 289. 212. gbbct29.seq - Bacterial sequence entries, part 29. 213. gbbct290.seq - Bacterial sequence entries, part 290. 214. gbbct291.seq - Bacterial sequence entries, part 291. 215. gbbct292.seq - Bacterial sequence entries, part 292. 216. gbbct293.seq - Bacterial sequence entries, part 293. 217. gbbct294.seq - Bacterial sequence entries, part 294. 218. gbbct295.seq - Bacterial sequence entries, part 295. 219. gbbct296.seq - Bacterial sequence entries, part 296. 220. gbbct297.seq - Bacterial sequence entries, part 297. 221. gbbct298.seq - Bacterial sequence entries, part 298. 222. gbbct299.seq - Bacterial sequence entries, part 299. 223. gbbct3.seq - Bacterial sequence entries, part 3. 224. gbbct30.seq - Bacterial sequence entries, part 30. 225. gbbct300.seq - Bacterial sequence entries, part 300. 226. gbbct301.seq - Bacterial sequence entries, part 301. 227. gbbct302.seq - Bacterial sequence entries, part 302. 228. gbbct303.seq - Bacterial sequence entries, part 303. 229. gbbct304.seq - Bacterial sequence entries, part 304. 230. gbbct305.seq - Bacterial sequence entries, part 305. 231. gbbct306.seq - Bacterial sequence entries, part 306. 232. gbbct307.seq - Bacterial sequence entries, part 307. 233. gbbct308.seq - Bacterial sequence entries, part 308. 234. gbbct309.seq - Bacterial sequence entries, part 309. 235. gbbct31.seq - Bacterial sequence entries, part 31. 236. gbbct310.seq - Bacterial sequence entries, part 310. 237. gbbct311.seq - Bacterial sequence entries, part 311. 238. gbbct312.seq - Bacterial sequence entries, part 312. 239. gbbct313.seq - Bacterial sequence entries, part 313. 240. gbbct314.seq - Bacterial sequence entries, part 314. 241. gbbct315.seq - Bacterial sequence entries, part 315. 242. gbbct316.seq - Bacterial sequence entries, part 316. 243. gbbct317.seq - Bacterial sequence entries, part 317. 244. gbbct318.seq - Bacterial sequence entries, part 318. 245. gbbct319.seq - Bacterial sequence entries, part 319. 246. gbbct32.seq - Bacterial sequence entries, part 32. 247. gbbct320.seq - Bacterial sequence entries, part 320. 248. gbbct321.seq - Bacterial sequence entries, part 321. 249. gbbct322.seq - Bacterial sequence entries, part 322. 250. gbbct323.seq - Bacterial sequence entries, part 323. 251. gbbct324.seq - Bacterial sequence entries, part 324. 252. gbbct325.seq - Bacterial sequence entries, part 325. 253. gbbct326.seq - Bacterial sequence entries, part 326. 254. gbbct327.seq - Bacterial sequence entries, part 327. 255. gbbct328.seq - Bacterial sequence entries, part 328. 256. gbbct329.seq - Bacterial sequence entries, part 329. 257. gbbct33.seq - Bacterial sequence entries, part 33. 258. gbbct330.seq - Bacterial sequence entries, part 330. 259. gbbct331.seq - Bacterial sequence entries, part 331. 260. gbbct332.seq - Bacterial sequence entries, part 332. 261. gbbct333.seq - Bacterial sequence entries, part 333. 262. gbbct334.seq - Bacterial sequence entries, part 334. 263. gbbct335.seq - Bacterial sequence entries, part 335. 264. gbbct336.seq - Bacterial sequence entries, part 336. 265. gbbct337.seq - Bacterial sequence entries, part 337. 266. gbbct338.seq - Bacterial sequence entries, part 338. 267. gbbct339.seq - Bacterial sequence entries, part 339. 268. gbbct34.seq - Bacterial sequence entries, part 34. 269. gbbct340.seq - Bacterial sequence entries, part 340. 270. gbbct341.seq - Bacterial sequence entries, part 341. 271. gbbct342.seq - Bacterial sequence entries, part 342. 272. gbbct343.seq - Bacterial sequence entries, part 343. 273. gbbct344.seq - Bacterial sequence entries, part 344. 274. gbbct345.seq - Bacterial sequence entries, part 345. 275. gbbct346.seq - Bacterial sequence entries, part 346. 276. gbbct347.seq - Bacterial sequence entries, part 347. 277. gbbct348.seq - Bacterial sequence entries, part 348. 278. gbbct349.seq - Bacterial sequence entries, part 349. 279. gbbct35.seq - Bacterial sequence entries, part 35. 280. gbbct350.seq - Bacterial sequence entries, part 350. 281. gbbct351.seq - Bacterial sequence entries, part 351. 282. gbbct352.seq - Bacterial sequence entries, part 352. 283. gbbct353.seq - Bacterial sequence entries, part 353. 284. gbbct354.seq - Bacterial sequence entries, part 354. 285. gbbct355.seq - Bacterial sequence entries, part 355. 286. gbbct356.seq - Bacterial sequence entries, part 356. 287. gbbct357.seq - Bacterial sequence entries, part 357. 288. gbbct358.seq - Bacterial sequence entries, part 358. 289. gbbct359.seq - Bacterial sequence entries, part 359. 290. gbbct36.seq - Bacterial sequence entries, part 36. 291. gbbct360.seq - Bacterial sequence entries, part 360. 292. gbbct361.seq - Bacterial sequence entries, part 361. 293. gbbct362.seq - Bacterial sequence entries, part 362. 294. gbbct363.seq - Bacterial sequence entries, part 363. 295. gbbct364.seq - Bacterial sequence entries, part 364. 296. gbbct365.seq - Bacterial sequence entries, part 365. 297. gbbct366.seq - Bacterial sequence entries, part 366. 298. gbbct367.seq - Bacterial sequence entries, part 367. 299. gbbct368.seq - Bacterial sequence entries, part 368. 300. gbbct369.seq - Bacterial sequence entries, part 369. 301. gbbct37.seq - Bacterial sequence entries, part 37. 302. gbbct370.seq - Bacterial sequence entries, part 370. 303. gbbct371.seq - Bacterial sequence entries, part 371. 304. gbbct372.seq - Bacterial sequence entries, part 372. 305. gbbct373.seq - Bacterial sequence entries, part 373. 306. gbbct374.seq - Bacterial sequence entries, part 374. 307. gbbct375.seq - Bacterial sequence entries, part 375. 308. gbbct376.seq - Bacterial sequence entries, part 376. 309. gbbct377.seq - Bacterial sequence entries, part 377. 310. gbbct378.seq - Bacterial sequence entries, part 378. 311. gbbct379.seq - Bacterial sequence entries, part 379. 312. gbbct38.seq - Bacterial sequence entries, part 38. 313. gbbct380.seq - Bacterial sequence entries, part 380. 314. gbbct381.seq - Bacterial sequence entries, part 381. 315. gbbct382.seq - Bacterial sequence entries, part 382. 316. gbbct383.seq - Bacterial sequence entries, part 383. 317. gbbct384.seq - Bacterial sequence entries, part 384. 318. gbbct385.seq - Bacterial sequence entries, part 385. 319. gbbct386.seq - Bacterial sequence entries, part 386. 320. gbbct387.seq - Bacterial sequence entries, part 387. 321. gbbct388.seq - Bacterial sequence entries, part 388. 322. gbbct389.seq - Bacterial sequence entries, part 389. 323. gbbct39.seq - Bacterial sequence entries, part 39. 324. gbbct390.seq - Bacterial sequence entries, part 390. 325. gbbct391.seq - Bacterial sequence entries, part 391. 326. gbbct392.seq - Bacterial sequence entries, part 392. 327. gbbct393.seq - Bacterial sequence entries, part 393. 328. gbbct394.seq - Bacterial sequence entries, part 394. 329. gbbct395.seq - Bacterial sequence entries, part 395. 330. gbbct396.seq - Bacterial sequence entries, part 396. 331. gbbct397.seq - Bacterial sequence entries, part 397. 332. gbbct398.seq - Bacterial sequence entries, part 398. 333. gbbct399.seq - Bacterial sequence entries, part 399. 334. gbbct4.seq - Bacterial sequence entries, part 4. 335. gbbct40.seq - Bacterial sequence entries, part 40. 336. gbbct400.seq - Bacterial sequence entries, part 400. 337. gbbct401.seq - Bacterial sequence entries, part 401. 338. gbbct402.seq - Bacterial sequence entries, part 402. 339. gbbct403.seq - Bacterial sequence entries, part 403. 340. gbbct404.seq - Bacterial sequence entries, part 404. 341. gbbct405.seq - Bacterial sequence entries, part 405. 342. gbbct406.seq - Bacterial sequence entries, part 406. 343. gbbct407.seq - Bacterial sequence entries, part 407. 344. gbbct408.seq - Bacterial sequence entries, part 408. 345. gbbct409.seq - Bacterial sequence entries, part 409. 346. gbbct41.seq - Bacterial sequence entries, part 41. 347. gbbct410.seq - Bacterial sequence entries, part 410. 348. gbbct411.seq - Bacterial sequence entries, part 411. 349. gbbct412.seq - Bacterial sequence entries, part 412. 350. gbbct413.seq - Bacterial sequence entries, part 413. 351. gbbct414.seq - Bacterial sequence entries, part 414. 352. gbbct415.seq - Bacterial sequence entries, part 415. 353. gbbct416.seq - Bacterial sequence entries, part 416. 354. gbbct417.seq - Bacterial sequence entries, part 417. 355. gbbct418.seq - Bacterial sequence entries, part 418. 356. gbbct419.seq - Bacterial sequence entries, part 419. 357. gbbct42.seq - Bacterial sequence entries, part 42. 358. gbbct420.seq - Bacterial sequence entries, part 420. 359. gbbct421.seq - Bacterial sequence entries, part 421. 360. gbbct422.seq - Bacterial sequence entries, part 422. 361. gbbct423.seq - Bacterial sequence entries, part 423. 362. gbbct424.seq - Bacterial sequence entries, part 424. 363. gbbct425.seq - Bacterial sequence entries, part 425. 364. gbbct426.seq - Bacterial sequence entries, part 426. 365. gbbct427.seq - Bacterial sequence entries, part 427. 366. gbbct428.seq - Bacterial sequence entries, part 428. 367. gbbct429.seq - Bacterial sequence entries, part 429. 368. gbbct43.seq - Bacterial sequence entries, part 43. 369. gbbct430.seq - Bacterial sequence entries, part 430. 370. gbbct431.seq - Bacterial sequence entries, part 431. 371. gbbct432.seq - Bacterial sequence entries, part 432. 372. gbbct433.seq - Bacterial sequence entries, part 433. 373. gbbct434.seq - Bacterial sequence entries, part 434. 374. gbbct435.seq - Bacterial sequence entries, part 435. 375. gbbct436.seq - Bacterial sequence entries, part 436. 376. gbbct437.seq - Bacterial sequence entries, part 437. 377. gbbct438.seq - Bacterial sequence entries, part 438. 378. gbbct439.seq - Bacterial sequence entries, part 439. 379. gbbct44.seq - Bacterial sequence entries, part 44. 380. gbbct440.seq - Bacterial sequence entries, part 440. 381. gbbct441.seq - Bacterial sequence entries, part 441. 382. gbbct442.seq - Bacterial sequence entries, part 442. 383. gbbct443.seq - Bacterial sequence entries, part 443. 384. gbbct444.seq - Bacterial sequence entries, part 444. 385. gbbct445.seq - Bacterial sequence entries, part 445. 386. gbbct446.seq - Bacterial sequence entries, part 446. 387. gbbct447.seq - Bacterial sequence entries, part 447. 388. gbbct448.seq - Bacterial sequence entries, part 448. 389. gbbct449.seq - Bacterial sequence entries, part 449. 390. gbbct45.seq - Bacterial sequence entries, part 45. 391. gbbct450.seq - Bacterial sequence entries, part 450. 392. gbbct451.seq - Bacterial sequence entries, part 451. 393. gbbct452.seq - Bacterial sequence entries, part 452. 394. gbbct453.seq - Bacterial sequence entries, part 453. 395. gbbct454.seq - Bacterial sequence entries, part 454. 396. gbbct455.seq - Bacterial sequence entries, part 455. 397. gbbct456.seq - Bacterial sequence entries, part 456. 398. gbbct457.seq - Bacterial sequence entries, part 457. 399. gbbct458.seq - Bacterial sequence entries, part 458. 400. gbbct459.seq - Bacterial sequence entries, part 459. 401. gbbct46.seq - Bacterial sequence entries, part 46. 402. gbbct460.seq - Bacterial sequence entries, part 460. 403. gbbct461.seq - Bacterial sequence entries, part 461. 404. gbbct462.seq - Bacterial sequence entries, part 462. 405. gbbct463.seq - Bacterial sequence entries, part 463. 406. gbbct464.seq - Bacterial sequence entries, part 464. 407. gbbct465.seq - Bacterial sequence entries, part 465. 408. gbbct466.seq - Bacterial sequence entries, part 466. 409. gbbct467.seq - Bacterial sequence entries, part 467. 410. gbbct468.seq - Bacterial sequence entries, part 468. 411. gbbct469.seq - Bacterial sequence entries, part 469. 412. gbbct47.seq - Bacterial sequence entries, part 47. 413. gbbct470.seq - Bacterial sequence entries, part 470. 414. gbbct471.seq - Bacterial sequence entries, part 471. 415. gbbct472.seq - Bacterial sequence entries, part 472. 416. gbbct473.seq - Bacterial sequence entries, part 473. 417. gbbct474.seq - Bacterial sequence entries, part 474. 418. gbbct475.seq - Bacterial sequence entries, part 475. 419. gbbct476.seq - Bacterial sequence entries, part 476. 420. gbbct477.seq - Bacterial sequence entries, part 477. 421. gbbct478.seq - Bacterial sequence entries, part 478. 422. gbbct479.seq - Bacterial sequence entries, part 479. 423. gbbct48.seq - Bacterial sequence entries, part 48. 424. gbbct480.seq - Bacterial sequence entries, part 480. 425. gbbct481.seq - Bacterial sequence entries, part 481. 426. gbbct482.seq - Bacterial sequence entries, part 482. 427. gbbct483.seq - Bacterial sequence entries, part 483. 428. gbbct484.seq - Bacterial sequence entries, part 484. 429. gbbct485.seq - Bacterial sequence entries, part 485. 430. gbbct486.seq - Bacterial sequence entries, part 486. 431. gbbct487.seq - Bacterial sequence entries, part 487. 432. gbbct488.seq - Bacterial sequence entries, part 488. 433. gbbct489.seq - Bacterial sequence entries, part 489. 434. gbbct49.seq - Bacterial sequence entries, part 49. 435. gbbct490.seq - Bacterial sequence entries, part 490. 436. gbbct491.seq - Bacterial sequence entries, part 491. 437. gbbct492.seq - Bacterial sequence entries, part 492. 438. gbbct493.seq - Bacterial sequence entries, part 493. 439. gbbct494.seq - Bacterial sequence entries, part 494. 440. gbbct495.seq - Bacterial sequence entries, part 495. 441. gbbct496.seq - Bacterial sequence entries, part 496. 442. gbbct497.seq - Bacterial sequence entries, part 497. 443. gbbct498.seq - Bacterial sequence entries, part 498. 444. gbbct499.seq - Bacterial sequence entries, part 499. 445. gbbct5.seq - Bacterial sequence entries, part 5. 446. gbbct50.seq - Bacterial sequence entries, part 50. 447. gbbct500.seq - Bacterial sequence entries, part 500. 448. gbbct501.seq - Bacterial sequence entries, part 501. 449. gbbct502.seq - Bacterial sequence entries, part 502. 450. gbbct503.seq - Bacterial sequence entries, part 503. 451. gbbct51.seq - Bacterial sequence entries, part 51. 452. gbbct52.seq - Bacterial sequence entries, part 52. 453. gbbct53.seq - Bacterial sequence entries, part 53. 454. gbbct54.seq - Bacterial sequence entries, part 54. 455. gbbct55.seq - Bacterial sequence entries, part 55. 456. gbbct56.seq - Bacterial sequence entries, part 56. 457. gbbct57.seq - Bacterial sequence entries, part 57. 458. gbbct58.seq - Bacterial sequence entries, part 58. 459. gbbct59.seq - Bacterial sequence entries, part 59. 460. gbbct6.seq - Bacterial sequence entries, part 6. 461. gbbct60.seq - Bacterial sequence entries, part 60. 462. gbbct61.seq - Bacterial sequence entries, part 61. 463. gbbct62.seq - Bacterial sequence entries, part 62. 464. gbbct63.seq - Bacterial sequence entries, part 63. 465. gbbct64.seq - Bacterial sequence entries, part 64. 466. gbbct65.seq - Bacterial sequence entries, part 65. 467. gbbct66.seq - Bacterial sequence entries, part 66. 468. gbbct67.seq - Bacterial sequence entries, part 67. 469. gbbct68.seq - Bacterial sequence entries, part 68. 470. gbbct69.seq - Bacterial sequence entries, part 69. 471. gbbct7.seq - Bacterial sequence entries, part 7. 472. gbbct70.seq - Bacterial sequence entries, part 70. 473. gbbct71.seq - Bacterial sequence entries, part 71. 474. gbbct72.seq - Bacterial sequence entries, part 72. 475. gbbct73.seq - Bacterial sequence entries, part 73. 476. gbbct74.seq - Bacterial sequence entries, part 74. 477. gbbct75.seq - Bacterial sequence entries, part 75. 478. gbbct76.seq - Bacterial sequence entries, part 76. 479. gbbct77.seq - Bacterial sequence entries, part 77. 480. gbbct78.seq - Bacterial sequence entries, part 78. 481. gbbct79.seq - Bacterial sequence entries, part 79. 482. gbbct8.seq - Bacterial sequence entries, part 8. 483. gbbct80.seq - Bacterial sequence entries, part 80. 484. gbbct81.seq - Bacterial sequence entries, part 81. 485. gbbct82.seq - Bacterial sequence entries, part 82. 486. gbbct83.seq - Bacterial sequence entries, part 83. 487. gbbct84.seq - Bacterial sequence entries, part 84. 488. gbbct85.seq - Bacterial sequence entries, part 85. 489. gbbct86.seq - Bacterial sequence entries, part 86. 490. gbbct87.seq - Bacterial sequence entries, part 87. 491. gbbct88.seq - Bacterial sequence entries, part 88. 492. gbbct89.seq - Bacterial sequence entries, part 89. 493. gbbct9.seq - Bacterial sequence entries, part 9. 494. gbbct90.seq - Bacterial sequence entries, part 90. 495. gbbct91.seq - Bacterial sequence entries, part 91. 496. gbbct92.seq - Bacterial sequence entries, part 92. 497. gbbct93.seq - Bacterial sequence entries, part 93. 498. gbbct94.seq - Bacterial sequence entries, part 94. 499. gbbct95.seq - Bacterial sequence entries, part 95. 500. gbbct96.seq - Bacterial sequence entries, part 96. 501. gbbct97.seq - Bacterial sequence entries, part 97. 502. gbbct98.seq - Bacterial sequence entries, part 98. 503. gbbct99.seq - Bacterial sequence entries, part 99. 504. gbchg.txt - Accession numbers of entries updated since the previous release. 505. gbcon1.seq - Constructed sequence entries, part 1. 506. gbcon10.seq - Constructed sequence entries, part 10. 507. gbcon11.seq - Constructed sequence entries, part 11. 508. gbcon12.seq - Constructed sequence entries, part 12. 509. gbcon13.seq - Constructed sequence entries, part 13. 510. gbcon14.seq - Constructed sequence entries, part 14. 511. gbcon15.seq - Constructed sequence entries, part 15. 512. gbcon16.seq - Constructed sequence entries, part 16. 513. gbcon17.seq - Constructed sequence entries, part 17. 514. gbcon18.seq - Constructed sequence entries, part 18. 515. gbcon19.seq - Constructed sequence entries, part 19. 516. gbcon2.seq - Constructed sequence entries, part 2. 517. gbcon20.seq - Constructed sequence entries, part 20. 518. gbcon21.seq - Constructed sequence entries, part 21. 519. gbcon22.seq - Constructed sequence entries, part 22. 520. gbcon23.seq - Constructed sequence entries, part 23. 521. gbcon24.seq - Constructed sequence entries, part 24. 522. gbcon25.seq - Constructed sequence entries, part 25. 523. gbcon26.seq - Constructed sequence entries, part 26. 524. gbcon27.seq - Constructed sequence entries, part 27. 525. gbcon28.seq - Constructed sequence entries, part 28. 526. gbcon29.seq - Constructed sequence entries, part 29. 527. gbcon3.seq - Constructed sequence entries, part 3. 528. gbcon30.seq - Constructed sequence entries, part 30. 529. gbcon31.seq - Constructed sequence entries, part 31. 530. gbcon32.seq - Constructed sequence entries, part 32. 531. gbcon33.seq - Constructed sequence entries, part 33. 532. gbcon34.seq - Constructed sequence entries, part 34. 533. gbcon35.seq - Constructed sequence entries, part 35. 534. gbcon36.seq - Constructed sequence entries, part 36. 535. gbcon37.seq - Constructed sequence entries, part 37. 536. gbcon38.seq - Constructed sequence entries, part 38. 537. gbcon39.seq - Constructed sequence entries, part 39. 538. gbcon4.seq - Constructed sequence entries, part 4. 539. gbcon40.seq - Constructed sequence entries, part 40. 540. gbcon41.seq - Constructed sequence entries, part 41. 541. gbcon42.seq - Constructed sequence entries, part 42. 542. gbcon43.seq - Constructed sequence entries, part 43. 543. gbcon44.seq - Constructed sequence entries, part 44. 544. gbcon45.seq - Constructed sequence entries, part 45. 545. gbcon46.seq - Constructed sequence entries, part 46. 546. gbcon47.seq - Constructed sequence entries, part 47. 547. gbcon48.seq - Constructed sequence entries, part 48. 548. gbcon49.seq - Constructed sequence entries, part 49. 549. gbcon5.seq - Constructed sequence entries, part 5. 550. gbcon50.seq - Constructed sequence entries, part 50. 551. gbcon51.seq - Constructed sequence entries, part 51. 552. gbcon52.seq - Constructed sequence entries, part 52. 553. gbcon53.seq - Constructed sequence entries, part 53. 554. gbcon54.seq - Constructed sequence entries, part 54. 555. gbcon55.seq - Constructed sequence entries, part 55. 556. gbcon56.seq - Constructed sequence entries, part 56. 557. gbcon57.seq - Constructed sequence entries, part 57. 558. gbcon58.seq - Constructed sequence entries, part 58. 559. gbcon59.seq - Constructed sequence entries, part 59. 560. gbcon6.seq - Constructed sequence entries, part 6. 561. gbcon60.seq - Constructed sequence entries, part 60. 562. gbcon61.seq - Constructed sequence entries, part 61. 563. gbcon62.seq - Constructed sequence entries, part 62. 564. gbcon63.seq - Constructed sequence entries, part 63. 565. gbcon64.seq - Constructed sequence entries, part 64. 566. gbcon65.seq - Constructed sequence entries, part 65. 567. gbcon66.seq - Constructed sequence entries, part 66. 568. gbcon67.seq - Constructed sequence entries, part 67. 569. gbcon68.seq - Constructed sequence entries, part 68. 570. gbcon69.seq - Constructed sequence entries, part 69. (Patched to con68) 571. gbcon7.seq - Constructed sequence entries, part 7. 572. gbcon8.seq - Constructed sequence entries, part 8. 573. gbcon9.seq - Constructed sequence entries, part 9. 574. gbdel.txt - Accession numbers of entries deleted since the previous release. 575. gbenv1.seq - Environmental sampling sequence entries, part 1. 576. gbenv10.seq - Environmental sampling sequence entries, part 10. 577. gbenv11.seq - Environmental sampling sequence entries, part 11. 578. gbenv12.seq - Environmental sampling sequence entries, part 12. 579. gbenv13.seq - Environmental sampling sequence entries, part 13. 580. gbenv14.seq - Environmental sampling sequence entries, part 14. 581. gbenv15.seq - Environmental sampling sequence entries, part 15. 582. gbenv16.seq - Environmental sampling sequence entries, part 16. 583. gbenv17.seq - Environmental sampling sequence entries, part 17. 584. gbenv18.seq - Environmental sampling sequence entries, part 18. 585. gbenv19.seq - Environmental sampling sequence entries, part 19. 586. gbenv2.seq - Environmental sampling sequence entries, part 2. 587. gbenv20.seq - Environmental sampling sequence entries, part 20. 588. gbenv21.seq - Environmental sampling sequence entries, part 21. 589. gbenv22.seq - Environmental sampling sequence entries, part 22. 590. gbenv23.seq - Environmental sampling sequence entries, part 23. 591. gbenv24.seq - Environmental sampling sequence entries, part 24. 592. gbenv25.seq - Environmental sampling sequence entries, part 25. 593. gbenv26.seq - Environmental sampling sequence entries, part 26. 594. gbenv27.seq - Environmental sampling sequence entries, part 27. 595. gbenv28.seq - Environmental sampling sequence entries, part 28. 596. gbenv29.seq - Environmental sampling sequence entries, part 29. 597. gbenv3.seq - Environmental sampling sequence entries, part 3. 598. gbenv30.seq - Environmental sampling sequence entries, part 30. 599. gbenv31.seq - Environmental sampling sequence entries, part 31. 600. gbenv32.seq - Environmental sampling sequence entries, part 32. 601. gbenv33.seq - Environmental sampling sequence entries, part 33. 602. gbenv34.seq - Environmental sampling sequence entries, part 34. 603. gbenv35.seq - Environmental sampling sequence entries, part 35. 604. gbenv36.seq - Environmental sampling sequence entries, part 36. 605. gbenv37.seq - Environmental sampling sequence entries, part 37. 606. gbenv38.seq - Environmental sampling sequence entries, part 38. 607. gbenv39.seq - Environmental sampling sequence entries, part 39. 608. gbenv4.seq - Environmental sampling sequence entries, part 4. 609. gbenv40.seq - Environmental sampling sequence entries, part 40. 610. gbenv41.seq - Environmental sampling sequence entries, part 41. 611. gbenv5.seq - Environmental sampling sequence entries, part 5. 612. gbenv6.seq - Environmental sampling sequence entries, part 6. 613. gbenv7.seq - Environmental sampling sequence entries, part 7. 614. gbenv8.seq - Environmental sampling sequence entries, part 8. 615. gbenv9.seq - Environmental sampling sequence entries, part 9. 616. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1. 617. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10. 618. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100. 619. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101. 620. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102. 621. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103. 622. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104. 623. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105. 624. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106. 625. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107. 626. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108. 627. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109. 628. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11. 629. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110. 630. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111. 631. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112. 632. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113. 633. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114. 634. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115. 635. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116. 636. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117. 637. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118. 638. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119. 639. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12. 640. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120. 641. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121. 642. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122. 643. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123. 644. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124. 645. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125. 646. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126. 647. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127. 648. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128. 649. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129. 650. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13. 651. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130. 652. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131. 653. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132. 654. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133. 655. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134. 656. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135. 657. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136. 658. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137. 659. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138. 660. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139. 661. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14. 662. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140. 663. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141. 664. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142. 665. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143. 666. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144. 667. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145. 668. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146. 669. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147. 670. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148. 671. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149. 672. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15. 673. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150. 674. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151. 675. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152. 676. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153. 677. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154. 678. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155. 679. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156. 680. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157. 681. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158. 682. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159. 683. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16. 684. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160. 685. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161. 686. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162. 687. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163. 688. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164. 689. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17. 690. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18. 691. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19. 692. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2. 693. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20. 694. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21. 695. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22. 696. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23. 697. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24. 698. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25. 699. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26. 700. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27. 701. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28. 702. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29. 703. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3. 704. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30. 705. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31. 706. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32. 707. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33. 708. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34. 709. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35. 710. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36. 711. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37. 712. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38. 713. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39. 714. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4. 715. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40. 716. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41. 717. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42. 718. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43. 719. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44. 720. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45. 721. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46. 722. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47. 723. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48. 724. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49. 725. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5. 726. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50. 727. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51. 728. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52. 729. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53. 730. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54. 731. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55. 732. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56. 733. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57. 734. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58. 735. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59. 736. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6. 737. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60. 738. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61. 739. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62. 740. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63. 741. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64. 742. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65. 743. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66. 744. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67. 745. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68. 746. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69. 747. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7. 748. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70. 749. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71. 750. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72. 751. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73. 752. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74. 753. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75. 754. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76. 755. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77. 756. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78. 757. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79. 758. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8. 759. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80. 760. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81. 761. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82. 762. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83. 763. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84. 764. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85. 765. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86. 766. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87. 767. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88. 768. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89. 769. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9. 770. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90. 771. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91. 772. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92. 773. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93. 774. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94. 775. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95. 776. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96. 777. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97. 778. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98. 779. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99. 780. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1. 781. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10. 782. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11. 783. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12. 784. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13. 785. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14. 786. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15. 787. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16. 788. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17. 789. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18. 790. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19. 791. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2. 792. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20. 793. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21. 794. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22. 795. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23. 796. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24. 797. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25. 798. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26. 799. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27. 800. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28. 801. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29. 802. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3. 803. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30. 804. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31. 805. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32. 806. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33. 807. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34. 808. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35. 809. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36. 810. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37. 811. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38. 812. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39. 813. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4. 814. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40. 815. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41. 816. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42. 817. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43. 818. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44. 819. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45. 820. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46. 821. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47. 822. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48. 823. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49. 824. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5. 825. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50. 826. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51. 827. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52. 828. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53. 829. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54. 830. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55. 831. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56. 832. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57. 833. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58. 834. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59. 835. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6. 836. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60. 837. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61. 838. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62. 839. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63. 840. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64. 841. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65. 842. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66. 843. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67. 844. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68. 845. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69. 846. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7. 847. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70. 848. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71. 849. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72. 850. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73. 851. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74. 852. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75. 853. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76. 854. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77. 855. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78. 856. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79. 857. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8. 858. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9. 859. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1. 860. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2. 861. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3. 862. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1. 863. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10. 864. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11. 865. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12. 866. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13. 867. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14. 868. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15. 869. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16. 870. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17. 871. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18. 872. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19. 873. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2. 874. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20. 875. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21. 876. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22. 877. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23. 878. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24. 879. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25. 880. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3. 881. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4. 882. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5. 883. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6. 884. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7. 885. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8. 886. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9. 887. gbinv1.seq - Invertebrate sequence entries, part 1. 888. gbinv10.seq - Invertebrate sequence entries, part 10. 889. gbinv100.seq - Invertebrate sequence entries, part 100. 890. gbinv1000.seq - Invertebrate sequence entries, part 1000. 891. gbinv1001.seq - Invertebrate sequence entries, part 1001. 892. gbinv1002.seq - Invertebrate sequence entries, part 1002. 893. gbinv1003.seq - Invertebrate sequence entries, part 1003. 894. gbinv1004.seq - Invertebrate sequence entries, part 1004. 895. gbinv1005.seq - Invertebrate sequence entries, part 1005. 896. gbinv1006.seq - Invertebrate sequence entries, part 1006. 897. gbinv1007.seq - Invertebrate sequence entries, part 1007. 898. gbinv1008.seq - Invertebrate sequence entries, part 1008. 899. gbinv1009.seq - Invertebrate sequence entries, part 1009. 900. gbinv101.seq - Invertebrate sequence entries, part 101. 901. gbinv1010.seq - Invertebrate sequence entries, part 1010. 902. gbinv1011.seq - Invertebrate sequence entries, part 1011. 903. gbinv1012.seq - Invertebrate sequence entries, part 1012. 904. gbinv1013.seq - Invertebrate sequence entries, part 1013. 905. gbinv1014.seq - Invertebrate sequence entries, part 1014. 906. gbinv1015.seq - Invertebrate sequence entries, part 1015. 907. gbinv1016.seq - Invertebrate sequence entries, part 1016. 908. gbinv1017.seq - Invertebrate sequence entries, part 1017. 909. gbinv1018.seq - Invertebrate sequence entries, part 1018. 910. gbinv1019.seq - Invertebrate sequence entries, part 1019. 911. gbinv102.seq - Invertebrate sequence entries, part 102. 912. gbinv1020.seq - Invertebrate sequence entries, part 1020. 913. gbinv1021.seq - Invertebrate sequence entries, part 1021. 914. gbinv1022.seq - Invertebrate sequence entries, part 1022. 915. gbinv1023.seq - Invertebrate sequence entries, part 1023. 916. gbinv1024.seq - Invertebrate sequence entries, part 1024. 917. gbinv1025.seq - Invertebrate sequence entries, part 1025. 918. gbinv1026.seq - Invertebrate sequence entries, part 1026. 919. gbinv1027.seq - Invertebrate sequence entries, part 1027. 920. gbinv1028.seq - Invertebrate sequence entries, part 1028. 921. gbinv1029.seq - Invertebrate sequence entries, part 1029. 922. gbinv103.seq - Invertebrate sequence entries, part 103. 923. gbinv1030.seq - Invertebrate sequence entries, part 1030. 924. gbinv1031.seq - Invertebrate sequence entries, part 1031. 925. gbinv1032.seq - Invertebrate sequence entries, part 1032. 926. gbinv1033.seq - Invertebrate sequence entries, part 1033. 927. gbinv1034.seq - Invertebrate sequence entries, part 1034. 928. gbinv1035.seq - Invertebrate sequence entries, part 1035. 929. gbinv1036.seq - Invertebrate sequence entries, part 1036. 930. gbinv1037.seq - Invertebrate sequence entries, part 1037. 931. gbinv1038.seq - Invertebrate sequence entries, part 1038. 932. gbinv1039.seq - Invertebrate sequence entries, part 1039. 933. gbinv104.seq - Invertebrate sequence entries, part 104. 934. gbinv1040.seq - Invertebrate sequence entries, part 1040. 935. gbinv1041.seq - Invertebrate sequence entries, part 1041. 936. gbinv1042.seq - Invertebrate sequence entries, part 1042. 937. gbinv1043.seq - Invertebrate sequence entries, part 1043. 938. gbinv1044.seq - Invertebrate sequence entries, part 1044. 939. gbinv1045.seq - Invertebrate sequence entries, part 1045. 940. gbinv1046.seq - Invertebrate sequence entries, part 1046. 941. gbinv1047.seq - Invertebrate sequence entries, part 1047. 942. gbinv1048.seq - Invertebrate sequence entries, part 1048. 943. gbinv1049.seq - Invertebrate sequence entries, part 1049. 944. gbinv105.seq - Invertebrate sequence entries, part 105. 945. gbinv1050.seq - Invertebrate sequence entries, part 1050. 946. gbinv1051.seq - Invertebrate sequence entries, part 1051. 947. gbinv1052.seq - Invertebrate sequence entries, part 1052. 948. gbinv1053.seq - Invertebrate sequence entries, part 1053. 949. gbinv1054.seq - Invertebrate sequence entries, part 1054. 950. gbinv1055.seq - Invertebrate sequence entries, part 1055. 951. gbinv1056.seq - Invertebrate sequence entries, part 1056. 952. gbinv1057.seq - Invertebrate sequence entries, part 1057. 953. gbinv1058.seq - Invertebrate sequence entries, part 1058. 954. gbinv1059.seq - Invertebrate sequence entries, part 1059. 955. gbinv106.seq - Invertebrate sequence entries, part 106. 956. gbinv1060.seq - Invertebrate sequence entries, part 1060. 957. gbinv1061.seq - Invertebrate sequence entries, part 1061. 958. gbinv1062.seq - Invertebrate sequence entries, part 1062. 959. gbinv1063.seq - Invertebrate sequence entries, part 1063. 960. gbinv1064.seq - Invertebrate sequence entries, part 1064. 961. gbinv1065.seq - Invertebrate sequence entries, part 1065. 962. gbinv1066.seq - Invertebrate sequence entries, part 1066. 963. gbinv1067.seq - Invertebrate sequence entries, part 1067. 964. gbinv1068.seq - Invertebrate sequence entries, part 1068. 965. gbinv1069.seq - Invertebrate sequence entries, part 1069. 966. gbinv107.seq - Invertebrate sequence entries, part 107. 967. gbinv1070.seq - Invertebrate sequence entries, part 1070. 968. gbinv1071.seq - Invertebrate sequence entries, part 1071. 969. gbinv1072.seq - Invertebrate sequence entries, part 1072. 970. gbinv1073.seq - Invertebrate sequence entries, part 1073. 971. gbinv1074.seq - Invertebrate sequence entries, part 1074. 972. gbinv1075.seq - Invertebrate sequence entries, part 1075. 973. gbinv1076.seq - Invertebrate sequence entries, part 1076. 974. gbinv1077.seq - Invertebrate sequence entries, part 1077. 975. gbinv1078.seq - Invertebrate sequence entries, part 1078. 976. gbinv1079.seq - Invertebrate sequence entries, part 1079. 977. gbinv108.seq - Invertebrate sequence entries, part 108. 978. gbinv1080.seq - Invertebrate sequence entries, part 1080. 979. gbinv1081.seq - Invertebrate sequence entries, part 1081. 980. gbinv1082.seq - Invertebrate sequence entries, part 1082. 981. gbinv1083.seq - Invertebrate sequence entries, part 1083. 982. gbinv1084.seq - Invertebrate sequence entries, part 1084. 983. gbinv1085.seq - Invertebrate sequence entries, part 1085. 984. gbinv1086.seq - Invertebrate sequence entries, part 1086. 985. gbinv1087.seq - Invertebrate sequence entries, part 1087. 986. gbinv1088.seq - Invertebrate sequence entries, part 1088. 987. gbinv1089.seq - Invertebrate sequence entries, part 1089. 988. gbinv109.seq - Invertebrate sequence entries, part 109. 989. gbinv1090.seq - Invertebrate sequence entries, part 1090. 990. gbinv1091.seq - Invertebrate sequence entries, part 1091. 991. gbinv1092.seq - Invertebrate sequence entries, part 1092. 992. gbinv1093.seq - Invertebrate sequence entries, part 1093. 993. gbinv1094.seq - Invertebrate sequence entries, part 1094. 994. gbinv1095.seq - Invertebrate sequence entries, part 1095. 995. gbinv1096.seq - Invertebrate sequence entries, part 1096. 996. gbinv1097.seq - Invertebrate sequence entries, part 1097. 997. gbinv1098.seq - Invertebrate sequence entries, part 1098. 998. gbinv1099.seq - Invertebrate sequence entries, part 1099. 999. gbinv11.seq - Invertebrate sequence entries, part 11. 1000. gbinv110.seq - Invertebrate sequence entries, part 110. 1001. gbinv1100.seq - Invertebrate sequence entries, part 1100. 1002. gbinv1101.seq - Invertebrate sequence entries, part 1101. 1003. gbinv1102.seq - Invertebrate sequence entries, part 1102. 1004. gbinv1103.seq - Invertebrate sequence entries, part 1103. 1005. gbinv1104.seq - Invertebrate sequence entries, part 1104. 1006. gbinv1105.seq - Invertebrate sequence entries, part 1105. 1007. gbinv1106.seq - Invertebrate sequence entries, part 1106. 1008. gbinv1107.seq - Invertebrate sequence entries, part 1107. 1009. gbinv1108.seq - Invertebrate sequence entries, part 1108. 1010. gbinv1109.seq - Invertebrate sequence entries, part 1109. 1011. gbinv111.seq - Invertebrate sequence entries, part 111. 1012. gbinv1110.seq - Invertebrate sequence entries, part 1110. 1013. gbinv1111.seq - Invertebrate sequence entries, part 1111. 1014. gbinv1112.seq - Invertebrate sequence entries, part 1112. 1015. gbinv1113.seq - Invertebrate sequence entries, part 1113. 1016. gbinv1114.seq - Invertebrate sequence entries, part 1114. 1017. gbinv1115.seq - Invertebrate sequence entries, part 1115. 1018. gbinv1116.seq - Invertebrate sequence entries, part 1116. 1019. gbinv1117.seq - Invertebrate sequence entries, part 1117. 1020. gbinv1118.seq - Invertebrate sequence entries, part 1118. 1021. gbinv1119.seq - Invertebrate sequence entries, part 1119. 1022. gbinv112.seq - Invertebrate sequence entries, part 112. 1023. gbinv1120.seq - Invertebrate sequence entries, part 1120. 1024. gbinv1121.seq - Invertebrate sequence entries, part 1121. 1025. gbinv1122.seq - Invertebrate sequence entries, part 1122. 1026. gbinv1123.seq - Invertebrate sequence entries, part 1123. 1027. gbinv1124.seq - Invertebrate sequence entries, part 1124. 1028. gbinv1125.seq - Invertebrate sequence entries, part 1125. 1029. gbinv1126.seq - Invertebrate sequence entries, part 1126. 1030. gbinv1127.seq - Invertebrate sequence entries, part 1127. 1031. gbinv1128.seq - Invertebrate sequence entries, part 1128. 1032. gbinv1129.seq - Invertebrate sequence entries, part 1129. 1033. gbinv113.seq - Invertebrate sequence entries, part 113. 1034. gbinv1130.seq - Invertebrate sequence entries, part 1130. 1035. gbinv1131.seq - Invertebrate sequence entries, part 1131. 1036. gbinv1132.seq - Invertebrate sequence entries, part 1132. 1037. gbinv1133.seq - Invertebrate sequence entries, part 1133. 1038. gbinv1134.seq - Invertebrate sequence entries, part 1134. 1039. gbinv1135.seq - Invertebrate sequence entries, part 1135. 1040. gbinv1136.seq - Invertebrate sequence entries, part 1136. 1041. gbinv1137.seq - Invertebrate sequence entries, part 1137. 1042. gbinv1138.seq - Invertebrate sequence entries, part 1138. 1043. gbinv1139.seq - Invertebrate sequence entries, part 1139. 1044. gbinv114.seq - Invertebrate sequence entries, part 114. 1045. gbinv1140.seq - Invertebrate sequence entries, part 1140. 1046. gbinv1141.seq - Invertebrate sequence entries, part 1141. 1047. gbinv1142.seq - Invertebrate sequence entries, part 1142. 1048. gbinv1143.seq - Invertebrate sequence entries, part 1143. 1049. gbinv1144.seq - Invertebrate sequence entries, part 1144. 1050. gbinv1145.seq - Invertebrate sequence entries, part 1145. 1051. gbinv1146.seq - Invertebrate sequence entries, part 1146. 1052. gbinv1147.seq - Invertebrate sequence entries, part 1147. 1053. gbinv1148.seq - Invertebrate sequence entries, part 1148. 1054. gbinv1149.seq - Invertebrate sequence entries, part 1149. 1055. gbinv115.seq - Invertebrate sequence entries, part 115. 1056. gbinv1150.seq - Invertebrate sequence entries, part 1150. 1057. gbinv1151.seq - Invertebrate sequence entries, part 1151. 1058. gbinv1152.seq - Invertebrate sequence entries, part 1152. 1059. gbinv1153.seq - Invertebrate sequence entries, part 1153. 1060. gbinv1154.seq - Invertebrate sequence entries, part 1154. 1061. gbinv1155.seq - Invertebrate sequence entries, part 1155. 1062. gbinv1156.seq - Invertebrate sequence entries, part 1156. 1063. gbinv1157.seq - Invertebrate sequence entries, part 1157. 1064. gbinv1158.seq - Invertebrate sequence entries, part 1158. 1065. gbinv1159.seq - Invertebrate sequence entries, part 1159. 1066. gbinv116.seq - Invertebrate sequence entries, part 116. 1067. gbinv1160.seq - Invertebrate sequence entries, part 1160. 1068. gbinv1161.seq - Invertebrate sequence entries, part 1161. 1069. gbinv1162.seq - Invertebrate sequence entries, part 1162. 1070. gbinv1163.seq - Invertebrate sequence entries, part 1163. 1071. gbinv1164.seq - Invertebrate sequence entries, part 1164. 1072. gbinv1165.seq - Invertebrate sequence entries, part 1165. 1073. gbinv1166.seq - Invertebrate sequence entries, part 1166. 1074. gbinv1167.seq - Invertebrate sequence entries, part 1167. 1075. gbinv1168.seq - Invertebrate sequence entries, part 1168. 1076. gbinv1169.seq - Invertebrate sequence entries, part 1169. 1077. gbinv117.seq - Invertebrate sequence entries, part 117. 1078. gbinv1170.seq - Invertebrate sequence entries, part 1170. 1079. gbinv1171.seq - Invertebrate sequence entries, part 1171. 1080. gbinv1172.seq - Invertebrate sequence entries, part 1172. 1081. gbinv1173.seq - Invertebrate sequence entries, part 1173. 1082. gbinv1174.seq - Invertebrate sequence entries, part 1174. 1083. gbinv1175.seq - Invertebrate sequence entries, part 1175. 1084. gbinv1176.seq - Invertebrate sequence entries, part 1176. 1085. gbinv1177.seq - Invertebrate sequence entries, part 1177. 1086. gbinv1178.seq - Invertebrate sequence entries, part 1178. 1087. gbinv1179.seq - Invertebrate sequence entries, part 1179. 1088. gbinv118.seq - Invertebrate sequence entries, part 118. 1089. gbinv1180.seq - Invertebrate sequence entries, part 1180. 1090. gbinv1181.seq - Invertebrate sequence entries, part 1181. 1091. gbinv1182.seq - Invertebrate sequence entries, part 1182. 1092. gbinv1183.seq - Invertebrate sequence entries, part 1183. 1093. gbinv1184.seq - Invertebrate sequence entries, part 1184. 1094. gbinv1185.seq - Invertebrate sequence entries, part 1185. 1095. gbinv1186.seq - Invertebrate sequence entries, part 1186. 1096. gbinv1187.seq - Invertebrate sequence entries, part 1187. 1097. gbinv1188.seq - Invertebrate sequence entries, part 1188. 1098. gbinv1189.seq - Invertebrate sequence entries, part 1189. 1099. gbinv119.seq - Invertebrate sequence entries, part 119. 1100. gbinv1190.seq - Invertebrate sequence entries, part 1190. 1101. gbinv1191.seq - Invertebrate sequence entries, part 1191. 1102. gbinv1192.seq - Invertebrate sequence entries, part 1192. 1103. gbinv1193.seq - Invertebrate sequence entries, part 1193. 1104. gbinv1194.seq - Invertebrate sequence entries, part 1194. 1105. gbinv1195.seq - Invertebrate sequence entries, part 1195. 1106. gbinv1196.seq - Invertebrate sequence entries, part 1196. 1107. gbinv1197.seq - Invertebrate sequence entries, part 1197. 1108. gbinv1198.seq - Invertebrate sequence entries, part 1198. 1109. gbinv1199.seq - Invertebrate sequence entries, part 1199. 1110. gbinv12.seq - Invertebrate sequence entries, part 12. 1111. gbinv120.seq - Invertebrate sequence entries, part 120. 1112. gbinv1200.seq - Invertebrate sequence entries, part 1200. 1113. gbinv1201.seq - Invertebrate sequence entries, part 1201. 1114. gbinv1202.seq - Invertebrate sequence entries, part 1202. 1115. gbinv1203.seq - Invertebrate sequence entries, part 1203. 1116. gbinv1204.seq - Invertebrate sequence entries, part 1204. 1117. gbinv1205.seq - Invertebrate sequence entries, part 1205. 1118. gbinv1206.seq - Invertebrate sequence entries, part 1206. 1119. gbinv1207.seq - Invertebrate sequence entries, part 1207. 1120. gbinv1208.seq - Invertebrate sequence entries, part 1208. 1121. gbinv1209.seq - Invertebrate sequence entries, part 1209. 1122. gbinv121.seq - Invertebrate sequence entries, part 121. 1123. gbinv1210.seq - Invertebrate sequence entries, part 1210. 1124. gbinv1211.seq - Invertebrate sequence entries, part 1211. 1125. gbinv1212.seq - Invertebrate sequence entries, part 1212. 1126. gbinv1213.seq - Invertebrate sequence entries, part 1213. 1127. gbinv1214.seq - Invertebrate sequence entries, part 1214. 1128. gbinv1215.seq - Invertebrate sequence entries, part 1215. 1129. gbinv1216.seq - Invertebrate sequence entries, part 1216. 1130. gbinv1217.seq - Invertebrate sequence entries, part 1217. 1131. gbinv1218.seq - Invertebrate sequence entries, part 1218. 1132. gbinv1219.seq - Invertebrate sequence entries, part 1219. 1133. gbinv122.seq - Invertebrate sequence entries, part 122. 1134. gbinv1220.seq - Invertebrate sequence entries, part 1220. 1135. gbinv1221.seq - Invertebrate sequence entries, part 1221. 1136. gbinv1222.seq - Invertebrate sequence entries, part 1222. 1137. gbinv1223.seq - Invertebrate sequence entries, part 1223. 1138. gbinv1224.seq - Invertebrate sequence entries, part 1224. 1139. gbinv1225.seq - Invertebrate sequence entries, part 1225. 1140. gbinv1226.seq - Invertebrate sequence entries, part 1226. 1141. gbinv1227.seq - Invertebrate sequence entries, part 1227. 1142. gbinv1228.seq - Invertebrate sequence entries, part 1228. 1143. gbinv1229.seq - Invertebrate sequence entries, part 1229. 1144. gbinv123.seq - Invertebrate sequence entries, part 123. 1145. gbinv1230.seq - Invertebrate sequence entries, part 1230. 1146. gbinv1231.seq - Invertebrate sequence entries, part 1231. 1147. gbinv1232.seq - Invertebrate sequence entries, part 1232. 1148. gbinv1233.seq - Invertebrate sequence entries, part 1233. 1149. gbinv1234.seq - Invertebrate sequence entries, part 1234. 1150. gbinv1235.seq - Invertebrate sequence entries, part 1235. 1151. gbinv1236.seq - Invertebrate sequence entries, part 1236. 1152. gbinv1237.seq - Invertebrate sequence entries, part 1237. 1153. gbinv1238.seq - Invertebrate sequence entries, part 1238. 1154. gbinv1239.seq - Invertebrate sequence entries, part 1239. 1155. gbinv124.seq - Invertebrate sequence entries, part 124. 1156. gbinv1240.seq - Invertebrate sequence entries, part 1240. 1157. gbinv1241.seq - Invertebrate sequence entries, part 1241. 1158. gbinv1242.seq - Invertebrate sequence entries, part 1242. 1159. gbinv1243.seq - Invertebrate sequence entries, part 1243. 1160. gbinv1244.seq - Invertebrate sequence entries, part 1244. 1161. gbinv1245.seq - Invertebrate sequence entries, part 1245. 1162. gbinv1246.seq - Invertebrate sequence entries, part 1246. 1163. gbinv1247.seq - Invertebrate sequence entries, part 1247. 1164. gbinv1248.seq - Invertebrate sequence entries, part 1248. 1165. gbinv1249.seq - Invertebrate sequence entries, part 1249. 1166. gbinv125.seq - Invertebrate sequence entries, part 125. 1167. gbinv1250.seq - Invertebrate sequence entries, part 1250. 1168. gbinv1251.seq - Invertebrate sequence entries, part 1251. 1169. gbinv1252.seq - Invertebrate sequence entries, part 1252. 1170. gbinv1253.seq - Invertebrate sequence entries, part 1253. 1171. gbinv1254.seq - Invertebrate sequence entries, part 1254. 1172. gbinv1255.seq - Invertebrate sequence entries, part 1255. 1173. gbinv1256.seq - Invertebrate sequence entries, part 1256. 1174. gbinv1257.seq - Invertebrate sequence entries, part 1257. 1175. gbinv1258.seq - Invertebrate sequence entries, part 1258. 1176. gbinv1259.seq - Invertebrate sequence entries, part 1259. 1177. gbinv126.seq - Invertebrate sequence entries, part 126. 1178. gbinv1260.seq - Invertebrate sequence entries, part 1260. 1179. gbinv1261.seq - Invertebrate sequence entries, part 1261. 1180. gbinv1262.seq - Invertebrate sequence entries, part 1262. 1181. gbinv1263.seq - Invertebrate sequence entries, part 1263. 1182. gbinv1264.seq - Invertebrate sequence entries, part 1264. 1183. gbinv1265.seq - Invertebrate sequence entries, part 1265. 1184. gbinv1266.seq - Invertebrate sequence entries, part 1266. 1185. gbinv1267.seq - Invertebrate sequence entries, part 1267. 1186. gbinv1268.seq - Invertebrate sequence entries, part 1268. 1187. gbinv1269.seq - Invertebrate sequence entries, part 1269. 1188. gbinv127.seq - Invertebrate sequence entries, part 127. 1189. gbinv1270.seq - Invertebrate sequence entries, part 1270. 1190. gbinv1271.seq - Invertebrate sequence entries, part 1271. 1191. gbinv1272.seq - Invertebrate sequence entries, part 1272. 1192. gbinv1273.seq - Invertebrate sequence entries, part 1273. 1193. gbinv1274.seq - Invertebrate sequence entries, part 1274. 1194. gbinv1275.seq - Invertebrate sequence entries, part 1275. 1195. gbinv1276.seq - Invertebrate sequence entries, part 1276. 1196. gbinv1277.seq - Invertebrate sequence entries, part 1277. 1197. gbinv1278.seq - Invertebrate sequence entries, part 1278. 1198. gbinv1279.seq - Invertebrate sequence entries, part 1279. 1199. gbinv128.seq - Invertebrate sequence entries, part 128. 1200. gbinv1280.seq - Invertebrate sequence entries, part 1280. 1201. gbinv1281.seq - Invertebrate sequence entries, part 1281. 1202. gbinv1282.seq - Invertebrate sequence entries, part 1282. 1203. gbinv1283.seq - Invertebrate sequence entries, part 1283. 1204. gbinv1284.seq - Invertebrate sequence entries, part 1284. 1205. gbinv1285.seq - Invertebrate sequence entries, part 1285. 1206. gbinv1286.seq - Invertebrate sequence entries, part 1286. 1207. gbinv1287.seq - Invertebrate sequence entries, part 1287. 1208. gbinv1288.seq - Invertebrate sequence entries, part 1288. 1209. gbinv1289.seq - Invertebrate sequence entries, part 1289. 1210. gbinv129.seq - Invertebrate sequence entries, part 129. 1211. gbinv1290.seq - Invertebrate sequence entries, part 1290. 1212. gbinv1291.seq - Invertebrate sequence entries, part 1291. 1213. gbinv1292.seq - Invertebrate sequence entries, part 1292. 1214. gbinv1293.seq - Invertebrate sequence entries, part 1293. 1215. gbinv1294.seq - Invertebrate sequence entries, part 1294. 1216. gbinv1295.seq - Invertebrate sequence entries, part 1295. 1217. gbinv1296.seq - Invertebrate sequence entries, part 1296. 1218. gbinv1297.seq - Invertebrate sequence entries, part 1297. 1219. gbinv1298.seq - Invertebrate sequence entries, part 1298. 1220. gbinv1299.seq - Invertebrate sequence entries, part 1299. 1221. gbinv13.seq - Invertebrate sequence entries, part 13. 1222. gbinv130.seq - Invertebrate sequence entries, part 130. 1223. gbinv1300.seq - Invertebrate sequence entries, part 1300. 1224. gbinv1301.seq - Invertebrate sequence entries, part 1301. 1225. gbinv1302.seq - Invertebrate sequence entries, part 1302. 1226. gbinv1303.seq - Invertebrate sequence entries, part 1303. 1227. gbinv1304.seq - Invertebrate sequence entries, part 1304. 1228. gbinv1305.seq - Invertebrate sequence entries, part 1305. 1229. gbinv1306.seq - Invertebrate sequence entries, part 1306. 1230. gbinv1307.seq - Invertebrate sequence entries, part 1307. 1231. gbinv1308.seq - Invertebrate sequence entries, part 1308. 1232. gbinv1309.seq - Invertebrate sequence entries, part 1309. 1233. gbinv131.seq - Invertebrate sequence entries, part 131. 1234. gbinv1310.seq - Invertebrate sequence entries, part 1310. 1235. gbinv1311.seq - Invertebrate sequence entries, part 1311. 1236. gbinv1312.seq - Invertebrate sequence entries, part 1312. 1237. gbinv1313.seq - Invertebrate sequence entries, part 1313. 1238. gbinv1314.seq - Invertebrate sequence entries, part 1314. 1239. gbinv1315.seq - Invertebrate sequence entries, part 1315. 1240. gbinv1316.seq - Invertebrate sequence entries, part 1316. 1241. gbinv1317.seq - Invertebrate sequence entries, part 1317. 1242. gbinv1318.seq - Invertebrate sequence entries, part 1318. 1243. gbinv1319.seq - Invertebrate sequence entries, part 1319. 1244. gbinv132.seq - Invertebrate sequence entries, part 132. 1245. gbinv1320.seq - Invertebrate sequence entries, part 1320. 1246. gbinv1321.seq - Invertebrate sequence entries, part 1321. 1247. gbinv1322.seq - Invertebrate sequence entries, part 1322. 1248. gbinv1323.seq - Invertebrate sequence entries, part 1323. 1249. gbinv1324.seq - Invertebrate sequence entries, part 1324. 1250. gbinv1325.seq - Invertebrate sequence entries, part 1325. 1251. gbinv1326.seq - Invertebrate sequence entries, part 1326. 1252. gbinv1327.seq - Invertebrate sequence entries, part 1327. 1253. gbinv1328.seq - Invertebrate sequence entries, part 1328. 1254. gbinv1329.seq - Invertebrate sequence entries, part 1329. 1255. gbinv133.seq - Invertebrate sequence entries, part 133. 1256. gbinv1330.seq - Invertebrate sequence entries, part 1330. 1257. gbinv1331.seq - Invertebrate sequence entries, part 1331. 1258. gbinv1332.seq - Invertebrate sequence entries, part 1332. 1259. gbinv1333.seq - Invertebrate sequence entries, part 1333. 1260. gbinv1334.seq - Invertebrate sequence entries, part 1334. 1261. gbinv1335.seq - Invertebrate sequence entries, part 1335. 1262. gbinv1336.seq - Invertebrate sequence entries, part 1336. 1263. gbinv1337.seq - Invertebrate sequence entries, part 1337. 1264. gbinv1338.seq - Invertebrate sequence entries, part 1338. 1265. gbinv1339.seq - Invertebrate sequence entries, part 1339. 1266. gbinv134.seq - Invertebrate sequence entries, part 134. 1267. gbinv1340.seq - Invertebrate sequence entries, part 1340. 1268. gbinv1341.seq - Invertebrate sequence entries, part 1341. 1269. gbinv1342.seq - Invertebrate sequence entries, part 1342. 1270. gbinv1343.seq - Invertebrate sequence entries, part 1343. 1271. gbinv1344.seq - Invertebrate sequence entries, part 1344. 1272. gbinv1345.seq - Invertebrate sequence entries, part 1345. 1273. gbinv1346.seq - Invertebrate sequence entries, part 1346. 1274. gbinv1347.seq - Invertebrate sequence entries, part 1347. 1275. gbinv1348.seq - Invertebrate sequence entries, part 1348. 1276. gbinv1349.seq - Invertebrate sequence entries, part 1349. 1277. gbinv135.seq - Invertebrate sequence entries, part 135. 1278. gbinv1350.seq - Invertebrate sequence entries, part 1350. 1279. gbinv1351.seq - Invertebrate sequence entries, part 1351. 1280. gbinv1352.seq - Invertebrate sequence entries, part 1352. 1281. gbinv1353.seq - Invertebrate sequence entries, part 1353. 1282. gbinv1354.seq - Invertebrate sequence entries, part 1354. 1283. gbinv1355.seq - Invertebrate sequence entries, part 1355. 1284. gbinv1356.seq - Invertebrate sequence entries, part 1356. 1285. gbinv1357.seq - Invertebrate sequence entries, part 1357. 1286. gbinv1358.seq - Invertebrate sequence entries, part 1358. 1287. gbinv1359.seq - Invertebrate sequence entries, part 1359. 1288. gbinv136.seq - Invertebrate sequence entries, part 136. 1289. gbinv1360.seq - Invertebrate sequence entries, part 1360. 1290. gbinv1361.seq - Invertebrate sequence entries, part 1361. 1291. gbinv1362.seq - Invertebrate sequence entries, part 1362. 1292. gbinv1363.seq - Invertebrate sequence entries, part 1363. 1293. gbinv1364.seq - Invertebrate sequence entries, part 1364. 1294. gbinv1365.seq - Invertebrate sequence entries, part 1365. 1295. gbinv1366.seq - Invertebrate sequence entries, part 1366. 1296. gbinv1367.seq - Invertebrate sequence entries, part 1367. 1297. gbinv1368.seq - Invertebrate sequence entries, part 1368. 1298. gbinv1369.seq - Invertebrate sequence entries, part 1369. 1299. gbinv137.seq - Invertebrate sequence entries, part 137. 1300. gbinv1370.seq - Invertebrate sequence entries, part 1370. 1301. gbinv1371.seq - Invertebrate sequence entries, part 1371. 1302. gbinv1372.seq - Invertebrate sequence entries, part 1372. 1303. gbinv1373.seq - Invertebrate sequence entries, part 1373. 1304. gbinv1374.seq - Invertebrate sequence entries, part 1374. 1305. gbinv1375.seq - Invertebrate sequence entries, part 1375. 1306. gbinv1376.seq - Invertebrate sequence entries, part 1376. 1307. gbinv1377.seq - Invertebrate sequence entries, part 1377. 1308. gbinv1378.seq - Invertebrate sequence entries, part 1378. 1309. gbinv1379.seq - Invertebrate sequence entries, part 1379. 1310. gbinv138.seq - Invertebrate sequence entries, part 138. 1311. gbinv1380.seq - Invertebrate sequence entries, part 1380. 1312. gbinv1381.seq - Invertebrate sequence entries, part 1381. 1313. gbinv1382.seq - Invertebrate sequence entries, part 1382. 1314. gbinv1383.seq - Invertebrate sequence entries, part 1383. 1315. gbinv1384.seq - Invertebrate sequence entries, part 1384. 1316. gbinv1385.seq - Invertebrate sequence entries, part 1385. 1317. gbinv1386.seq - Invertebrate sequence entries, part 1386. 1318. gbinv1387.seq - Invertebrate sequence entries, part 1387. 1319. gbinv1388.seq - Invertebrate sequence entries, part 1388. 1320. gbinv1389.seq - Invertebrate sequence entries, part 1389. 1321. gbinv139.seq - Invertebrate sequence entries, part 139. 1322. gbinv1390.seq - Invertebrate sequence entries, part 1390. 1323. gbinv1391.seq - Invertebrate sequence entries, part 1391. 1324. gbinv1392.seq - Invertebrate sequence entries, part 1392. 1325. gbinv1393.seq - Invertebrate sequence entries, part 1393. 1326. gbinv1394.seq - Invertebrate sequence entries, part 1394. 1327. gbinv1395.seq - Invertebrate sequence entries, part 1395. 1328. gbinv1396.seq - Invertebrate sequence entries, part 1396. 1329. gbinv1397.seq - Invertebrate sequence entries, part 1397. 1330. gbinv1398.seq - Invertebrate sequence entries, part 1398. 1331. gbinv1399.seq - Invertebrate sequence entries, part 1399. 1332. gbinv14.seq - Invertebrate sequence entries, part 14. 1333. gbinv140.seq - Invertebrate sequence entries, part 140. 1334. gbinv1400.seq - Invertebrate sequence entries, part 1400. 1335. gbinv1401.seq - Invertebrate sequence entries, part 1401. 1336. gbinv1402.seq - Invertebrate sequence entries, part 1402. 1337. gbinv1403.seq - Invertebrate sequence entries, part 1403. 1338. gbinv1404.seq - Invertebrate sequence entries, part 1404. 1339. gbinv1405.seq - Invertebrate sequence entries, part 1405. 1340. gbinv1406.seq - Invertebrate sequence entries, part 1406. 1341. gbinv1407.seq - Invertebrate sequence entries, part 1407. 1342. gbinv1408.seq - Invertebrate sequence entries, part 1408. 1343. gbinv1409.seq - Invertebrate sequence entries, part 1409. 1344. gbinv141.seq - Invertebrate sequence entries, part 141. 1345. gbinv1410.seq - Invertebrate sequence entries, part 1410. 1346. gbinv1411.seq - Invertebrate sequence entries, part 1411. 1347. gbinv1412.seq - Invertebrate sequence entries, part 1412. 1348. gbinv1413.seq - Invertebrate sequence entries, part 1413. 1349. gbinv1414.seq - Invertebrate sequence entries, part 1414. 1350. gbinv1415.seq - Invertebrate sequence entries, part 1415. 1351. gbinv1416.seq - Invertebrate sequence entries, part 1416. 1352. gbinv1417.seq - Invertebrate sequence entries, part 1417. 1353. gbinv1418.seq - Invertebrate sequence entries, part 1418. 1354. gbinv1419.seq - Invertebrate sequence entries, part 1419. 1355. gbinv142.seq - Invertebrate sequence entries, part 142. 1356. gbinv1420.seq - Invertebrate sequence entries, part 1420. 1357. gbinv1421.seq - Invertebrate sequence entries, part 1421. 1358. gbinv1422.seq - Invertebrate sequence entries, part 1422. 1359. gbinv1423.seq - Invertebrate sequence entries, part 1423. 1360. gbinv1424.seq - Invertebrate sequence entries, part 1424. 1361. gbinv1425.seq - Invertebrate sequence entries, part 1425. 1362. gbinv1426.seq - Invertebrate sequence entries, part 1426. 1363. gbinv1427.seq - Invertebrate sequence entries, part 1427. 1364. gbinv1428.seq - Invertebrate sequence entries, part 1428. 1365. gbinv1429.seq - Invertebrate sequence entries, part 1429. 1366. gbinv143.seq - Invertebrate sequence entries, part 143. 1367. gbinv1430.seq - Invertebrate sequence entries, part 1430. 1368. gbinv1431.seq - Invertebrate sequence entries, part 1431. 1369. gbinv1432.seq - Invertebrate sequence entries, part 1432. 1370. gbinv1433.seq - Invertebrate sequence entries, part 1433. 1371. gbinv1434.seq - Invertebrate sequence entries, part 1434. 1372. gbinv1435.seq - Invertebrate sequence entries, part 1435. 1373. gbinv1436.seq - Invertebrate sequence entries, part 1436. 1374. gbinv1437.seq - Invertebrate sequence entries, part 1437. 1375. gbinv1438.seq - Invertebrate sequence entries, part 1438. 1376. gbinv1439.seq - Invertebrate sequence entries, part 1439. 1377. gbinv144.seq - Invertebrate sequence entries, part 144. 1378. gbinv1440.seq - Invertebrate sequence entries, part 1440. 1379. gbinv1441.seq - Invertebrate sequence entries, part 1441. 1380. gbinv1442.seq - Invertebrate sequence entries, part 1442. 1381. gbinv1443.seq - Invertebrate sequence entries, part 1443. 1382. gbinv1444.seq - Invertebrate sequence entries, part 1444. 1383. gbinv1445.seq - Invertebrate sequence entries, part 1445. 1384. gbinv1446.seq - Invertebrate sequence entries, part 1446. 1385. gbinv1447.seq - Invertebrate sequence entries, part 1447. 1386. gbinv1448.seq - Invertebrate sequence entries, part 1448. 1387. gbinv1449.seq - Invertebrate sequence entries, part 1449. 1388. gbinv145.seq - Invertebrate sequence entries, part 145. 1389. gbinv1450.seq - Invertebrate sequence entries, part 1450. 1390. gbinv1451.seq - Invertebrate sequence entries, part 1451. 1391. gbinv1452.seq - Invertebrate sequence entries, part 1452. 1392. gbinv1453.seq - Invertebrate sequence entries, part 1453. 1393. gbinv1454.seq - Invertebrate sequence entries, part 1454. 1394. gbinv1455.seq - Invertebrate sequence entries, part 1455. 1395. gbinv1456.seq - Invertebrate sequence entries, part 1456. 1396. gbinv1457.seq - Invertebrate sequence entries, part 1457. 1397. gbinv1458.seq - Invertebrate sequence entries, part 1458. 1398. gbinv1459.seq - Invertebrate sequence entries, part 1459. 1399. gbinv146.seq - Invertebrate sequence entries, part 146. 1400. gbinv1460.seq - Invertebrate sequence entries, part 1460. 1401. gbinv1461.seq - Invertebrate sequence entries, part 1461. 1402. gbinv1462.seq - Invertebrate sequence entries, part 1462. 1403. gbinv1463.seq - Invertebrate sequence entries, part 1463. 1404. gbinv1464.seq - Invertebrate sequence entries, part 1464. 1405. gbinv1465.seq - Invertebrate sequence entries, part 1465. 1406. gbinv1466.seq - Invertebrate sequence entries, part 1466. 1407. gbinv1467.seq - Invertebrate sequence entries, part 1467. 1408. gbinv1468.seq - Invertebrate sequence entries, part 1468. 1409. gbinv1469.seq - Invertebrate sequence entries, part 1469. 1410. gbinv147.seq - Invertebrate sequence entries, part 147. 1411. gbinv1470.seq - Invertebrate sequence entries, part 1470. 1412. gbinv1471.seq - Invertebrate sequence entries, part 1471. 1413. gbinv1472.seq - Invertebrate sequence entries, part 1472. 1414. gbinv1473.seq - Invertebrate sequence entries, part 1473. 1415. gbinv1474.seq - Invertebrate sequence entries, part 1474. 1416. gbinv1475.seq - Invertebrate sequence entries, part 1475. 1417. gbinv1476.seq - Invertebrate sequence entries, part 1476. 1418. gbinv1477.seq - Invertebrate sequence entries, part 1477. 1419. gbinv1478.seq - Invertebrate sequence entries, part 1478. 1420. gbinv1479.seq - Invertebrate sequence entries, part 1479. 1421. gbinv148.seq - Invertebrate sequence entries, part 148. 1422. gbinv1480.seq - Invertebrate sequence entries, part 1480. 1423. gbinv1481.seq - Invertebrate sequence entries, part 1481. 1424. gbinv1482.seq - Invertebrate sequence entries, part 1482. 1425. gbinv1483.seq - Invertebrate sequence entries, part 1483. 1426. gbinv1484.seq - Invertebrate sequence entries, part 1484. 1427. gbinv1485.seq - Invertebrate sequence entries, part 1485. 1428. gbinv1486.seq - Invertebrate sequence entries, part 1486. 1429. gbinv1487.seq - Invertebrate sequence entries, part 1487. 1430. gbinv1488.seq - Invertebrate sequence entries, part 1488. 1431. gbinv1489.seq - Invertebrate sequence entries, part 1489. 1432. gbinv149.seq - Invertebrate sequence entries, part 149. 1433. gbinv1490.seq - Invertebrate sequence entries, part 1490. 1434. gbinv1491.seq - Invertebrate sequence entries, part 1491. 1435. gbinv1492.seq - Invertebrate sequence entries, part 1492. 1436. gbinv1493.seq - Invertebrate sequence entries, part 1493. 1437. gbinv1494.seq - Invertebrate sequence entries, part 1494. 1438. gbinv1495.seq - Invertebrate sequence entries, part 1495. 1439. gbinv1496.seq - Invertebrate sequence entries, part 1496. 1440. gbinv1497.seq - Invertebrate sequence entries, part 1497. 1441. gbinv1498.seq - Invertebrate sequence entries, part 1498. 1442. gbinv1499.seq - Invertebrate sequence entries, part 1499. 1443. gbinv15.seq - Invertebrate sequence entries, part 15. 1444. gbinv150.seq - Invertebrate sequence entries, part 150. 1445. gbinv1500.seq - Invertebrate sequence entries, part 1500. 1446. gbinv1501.seq - Invertebrate sequence entries, part 1501. 1447. gbinv1502.seq - Invertebrate sequence entries, part 1502. 1448. gbinv1503.seq - Invertebrate sequence entries, part 1503. 1449. gbinv1504.seq - Invertebrate sequence entries, part 1504. 1450. gbinv1505.seq - Invertebrate sequence entries, part 1505. 1451. gbinv1506.seq - Invertebrate sequence entries, part 1506. 1452. gbinv1507.seq - Invertebrate sequence entries, part 1507. 1453. gbinv1508.seq - Invertebrate sequence entries, part 1508. 1454. gbinv1509.seq - Invertebrate sequence entries, part 1509. 1455. gbinv151.seq - Invertebrate sequence entries, part 151. 1456. gbinv1510.seq - Invertebrate sequence entries, part 1510. 1457. gbinv1511.seq - Invertebrate sequence entries, part 1511. 1458. gbinv1512.seq - Invertebrate sequence entries, part 1512. 1459. gbinv1513.seq - Invertebrate sequence entries, part 1513. 1460. gbinv1514.seq - Invertebrate sequence entries, part 1514. 1461. gbinv1515.seq - Invertebrate sequence entries, part 1515. 1462. gbinv1516.seq - Invertebrate sequence entries, part 1516. 1463. gbinv1517.seq - Invertebrate sequence entries, part 1517. 1464. gbinv1518.seq - Invertebrate sequence entries, part 1518. 1465. gbinv1519.seq - Invertebrate sequence entries, part 1519. 1466. gbinv152.seq - Invertebrate sequence entries, part 152. 1467. gbinv1520.seq - Invertebrate sequence entries, part 1520. 1468. gbinv1521.seq - Invertebrate sequence entries, part 1521. 1469. gbinv1522.seq - Invertebrate sequence entries, part 1522. 1470. gbinv1523.seq - Invertebrate sequence entries, part 1523. 1471. gbinv1524.seq - Invertebrate sequence entries, part 1524. 1472. gbinv1525.seq - Invertebrate sequence entries, part 1525. 1473. gbinv1526.seq - Invertebrate sequence entries, part 1526. 1474. gbinv1527.seq - Invertebrate sequence entries, part 1527. 1475. gbinv1528.seq - Invertebrate sequence entries, part 1528. 1476. gbinv1529.seq - Invertebrate sequence entries, part 1529. 1477. gbinv153.seq - Invertebrate sequence entries, part 153. 1478. gbinv1530.seq - Invertebrate sequence entries, part 1530. 1479. gbinv1531.seq - Invertebrate sequence entries, part 1531. 1480. gbinv1532.seq - Invertebrate sequence entries, part 1532. 1481. gbinv1533.seq - Invertebrate sequence entries, part 1533. 1482. gbinv1534.seq - Invertebrate sequence entries, part 1534. 1483. gbinv1535.seq - Invertebrate sequence entries, part 1535. 1484. gbinv1536.seq - Invertebrate sequence entries, part 1536. 1485. gbinv1537.seq - Invertebrate sequence entries, part 1537. 1486. gbinv1538.seq - Invertebrate sequence entries, part 1538. 1487. gbinv1539.seq - Invertebrate sequence entries, part 1539. 1488. gbinv154.seq - Invertebrate sequence entries, part 154. 1489. gbinv1540.seq - Invertebrate sequence entries, part 1540. 1490. gbinv1541.seq - Invertebrate sequence entries, part 1541. 1491. gbinv1542.seq - Invertebrate sequence entries, part 1542. 1492. gbinv1543.seq - Invertebrate sequence entries, part 1543. 1493. gbinv1544.seq - Invertebrate sequence entries, part 1544. 1494. gbinv1545.seq - Invertebrate sequence entries, part 1545. 1495. gbinv1546.seq - Invertebrate sequence entries, part 1546. 1496. gbinv1547.seq - Invertebrate sequence entries, part 1547. 1497. gbinv1548.seq - Invertebrate sequence entries, part 1548. 1498. gbinv1549.seq - Invertebrate sequence entries, part 1549. 1499. gbinv155.seq - Invertebrate sequence entries, part 155. 1500. gbinv1550.seq - Invertebrate sequence entries, part 1550. 1501. gbinv1551.seq - Invertebrate sequence entries, part 1551. 1502. gbinv1552.seq - Invertebrate sequence entries, part 1552. 1503. gbinv1553.seq - Invertebrate sequence entries, part 1553. 1504. gbinv1554.seq - Invertebrate sequence entries, part 1554. 1505. gbinv1555.seq - Invertebrate sequence entries, part 1555. 1506. gbinv1556.seq - Invertebrate sequence entries, part 1556. 1507. gbinv1557.seq - Invertebrate sequence entries, part 1557. 1508. gbinv1558.seq - Invertebrate sequence entries, part 1558. 1509. gbinv1559.seq - Invertebrate sequence entries, part 1559. 1510. gbinv156.seq - Invertebrate sequence entries, part 156. 1511. gbinv1560.seq - Invertebrate sequence entries, part 1560. 1512. gbinv1561.seq - Invertebrate sequence entries, part 1561. 1513. gbinv1562.seq - Invertebrate sequence entries, part 1562. 1514. gbinv1563.seq - Invertebrate sequence entries, part 1563. 1515. gbinv1564.seq - Invertebrate sequence entries, part 1564. 1516. gbinv1565.seq - Invertebrate sequence entries, part 1565. 1517. gbinv1566.seq - Invertebrate sequence entries, part 1566. 1518. gbinv1567.seq - Invertebrate sequence entries, part 1567. 1519. gbinv1568.seq - Invertebrate sequence entries, part 1568. 1520. gbinv1569.seq - Invertebrate sequence entries, part 1569. 1521. gbinv157.seq - Invertebrate sequence entries, part 157. 1522. gbinv1570.seq - Invertebrate sequence entries, part 1570. 1523. gbinv1571.seq - Invertebrate sequence entries, part 1571. 1524. gbinv1572.seq - Invertebrate sequence entries, part 1572. 1525. gbinv1573.seq - Invertebrate sequence entries, part 1573. 1526. gbinv1574.seq - Invertebrate sequence entries, part 1574. 1527. gbinv1575.seq - Invertebrate sequence entries, part 1575. 1528. gbinv1576.seq - Invertebrate sequence entries, part 1576. 1529. gbinv1577.seq - Invertebrate sequence entries, part 1577. 1530. gbinv1578.seq - Invertebrate sequence entries, part 1578. 1531. gbinv1579.seq - Invertebrate sequence entries, part 1579. 1532. gbinv158.seq - Invertebrate sequence entries, part 158. 1533. gbinv1580.seq - Invertebrate sequence entries, part 1580. 1534. gbinv1581.seq - Invertebrate sequence entries, part 1581. 1535. gbinv1582.seq - Invertebrate sequence entries, part 1582. 1536. gbinv1583.seq - Invertebrate sequence entries, part 1583. 1537. gbinv1584.seq - Invertebrate sequence entries, part 1584. 1538. gbinv1585.seq - Invertebrate sequence entries, part 1585. 1539. gbinv1586.seq - Invertebrate sequence entries, part 1586. 1540. gbinv1587.seq - Invertebrate sequence entries, part 1587. 1541. gbinv1588.seq - Invertebrate sequence entries, part 1588. 1542. gbinv1589.seq - Invertebrate sequence entries, part 1589. 1543. gbinv159.seq - Invertebrate sequence entries, part 159. 1544. gbinv1590.seq - Invertebrate sequence entries, part 1590. 1545. gbinv1591.seq - Invertebrate sequence entries, part 1591. 1546. gbinv1592.seq - Invertebrate sequence entries, part 1592. 1547. gbinv1593.seq - Invertebrate sequence entries, part 1593. 1548. gbinv1594.seq - Invertebrate sequence entries, part 1594. 1549. gbinv1595.seq - Invertebrate sequence entries, part 1595. 1550. gbinv1596.seq - Invertebrate sequence entries, part 1596. 1551. gbinv1597.seq - Invertebrate sequence entries, part 1597. 1552. gbinv1598.seq - Invertebrate sequence entries, part 1598. 1553. gbinv1599.seq - Invertebrate sequence entries, part 1599. 1554. gbinv16.seq - Invertebrate sequence entries, part 16. 1555. gbinv160.seq - Invertebrate sequence entries, part 160. 1556. gbinv1600.seq - Invertebrate sequence entries, part 1600. 1557. gbinv1601.seq - Invertebrate sequence entries, part 1601. 1558. gbinv1602.seq - Invertebrate sequence entries, part 1602. 1559. gbinv1603.seq - Invertebrate sequence entries, part 1603. 1560. gbinv1604.seq - Invertebrate sequence entries, part 1604. 1561. gbinv1605.seq - Invertebrate sequence entries, part 1605. 1562. gbinv1606.seq - Invertebrate sequence entries, part 1606. 1563. gbinv1607.seq - Invertebrate sequence entries, part 1607. 1564. gbinv1608.seq - Invertebrate sequence entries, part 1608. 1565. gbinv1609.seq - Invertebrate sequence entries, part 1609. 1566. gbinv161.seq - Invertebrate sequence entries, part 161. 1567. gbinv1610.seq - Invertebrate sequence entries, part 1610. 1568. gbinv1611.seq - Invertebrate sequence entries, part 1611. 1569. gbinv1612.seq - Invertebrate sequence entries, part 1612. 1570. gbinv1613.seq - Invertebrate sequence entries, part 1613. 1571. gbinv1614.seq - Invertebrate sequence entries, part 1614. 1572. gbinv1615.seq - Invertebrate sequence entries, part 1615. 1573. gbinv1616.seq - Invertebrate sequence entries, part 1616. 1574. gbinv1617.seq - Invertebrate sequence entries, part 1617. 1575. gbinv1618.seq - Invertebrate sequence entries, part 1618. 1576. gbinv1619.seq - Invertebrate sequence entries, part 1619. 1577. gbinv162.seq - Invertebrate sequence entries, part 162. 1578. gbinv1620.seq - Invertebrate sequence entries, part 1620. 1579. gbinv1621.seq - Invertebrate sequence entries, part 1621. 1580. gbinv1622.seq - Invertebrate sequence entries, part 1622. 1581. gbinv1623.seq - Invertebrate sequence entries, part 1623. 1582. gbinv1624.seq - Invertebrate sequence entries, part 1624. 1583. gbinv1625.seq - Invertebrate sequence entries, part 1625. 1584. gbinv1626.seq - Invertebrate sequence entries, part 1626. 1585. gbinv1627.seq - Invertebrate sequence entries, part 1627. 1586. gbinv1628.seq - Invertebrate sequence entries, part 1628. 1587. gbinv1629.seq - Invertebrate sequence entries, part 1629. 1588. gbinv163.seq - Invertebrate sequence entries, part 163. 1589. gbinv1630.seq - Invertebrate sequence entries, part 1630. 1590. gbinv1631.seq - Invertebrate sequence entries, part 1631. 1591. gbinv1632.seq - Invertebrate sequence entries, part 1632. 1592. gbinv1633.seq - Invertebrate sequence entries, part 1633. 1593. gbinv1634.seq - Invertebrate sequence entries, part 1634. 1594. gbinv1635.seq - Invertebrate sequence entries, part 1635. 1595. gbinv1636.seq - Invertebrate sequence entries, part 1636. 1596. gbinv1637.seq - Invertebrate sequence entries, part 1637. 1597. gbinv1638.seq - Invertebrate sequence entries, part 1638. 1598. gbinv1639.seq - Invertebrate sequence entries, part 1639. 1599. gbinv164.seq - Invertebrate sequence entries, part 164. 1600. gbinv1640.seq - Invertebrate sequence entries, part 1640. 1601. gbinv1641.seq - Invertebrate sequence entries, part 1641. 1602. gbinv1642.seq - Invertebrate sequence entries, part 1642. 1603. gbinv1643.seq - Invertebrate sequence entries, part 1643. 1604. gbinv1644.seq - Invertebrate sequence entries, part 1644. 1605. gbinv1645.seq - Invertebrate sequence entries, part 1645. 1606. gbinv1646.seq - Invertebrate sequence entries, part 1646. 1607. gbinv1647.seq - Invertebrate sequence entries, part 1647. 1608. gbinv1648.seq - Invertebrate sequence entries, part 1648. 1609. gbinv1649.seq - Invertebrate sequence entries, part 1649. 1610. gbinv165.seq - Invertebrate sequence entries, part 165. 1611. gbinv1650.seq - Invertebrate sequence entries, part 1650. 1612. gbinv1651.seq - Invertebrate sequence entries, part 1651. 1613. gbinv1652.seq - Invertebrate sequence entries, part 1652. 1614. gbinv1653.seq - Invertebrate sequence entries, part 1653. 1615. gbinv1654.seq - Invertebrate sequence entries, part 1654. 1616. gbinv1655.seq - Invertebrate sequence entries, part 1655. 1617. gbinv1656.seq - Invertebrate sequence entries, part 1656. 1618. gbinv1657.seq - Invertebrate sequence entries, part 1657. 1619. gbinv1658.seq - Invertebrate sequence entries, part 1658. 1620. gbinv1659.seq - Invertebrate sequence entries, part 1659. 1621. gbinv166.seq - Invertebrate sequence entries, part 166. 1622. gbinv1660.seq - Invertebrate sequence entries, part 1660. 1623. gbinv1661.seq - Invertebrate sequence entries, part 1661. 1624. gbinv1662.seq - Invertebrate sequence entries, part 1662. 1625. gbinv1663.seq - Invertebrate sequence entries, part 1663. 1626. gbinv1664.seq - Invertebrate sequence entries, part 1664. 1627. gbinv1665.seq - Invertebrate sequence entries, part 1665. 1628. gbinv1666.seq - Invertebrate sequence entries, part 1666. 1629. gbinv1667.seq - Invertebrate sequence entries, part 1667. 1630. gbinv1668.seq - Invertebrate sequence entries, part 1668. 1631. gbinv1669.seq - Invertebrate sequence entries, part 1669. 1632. gbinv167.seq - Invertebrate sequence entries, part 167. 1633. gbinv1670.seq - Invertebrate sequence entries, part 1670. 1634. gbinv1671.seq - Invertebrate sequence entries, part 1671. 1635. gbinv1672.seq - Invertebrate sequence entries, part 1672. 1636. gbinv1673.seq - Invertebrate sequence entries, part 1673. 1637. gbinv1674.seq - Invertebrate sequence entries, part 1674. 1638. gbinv1675.seq - Invertebrate sequence entries, part 1675. 1639. gbinv1676.seq - Invertebrate sequence entries, part 1676. 1640. gbinv1677.seq - Invertebrate sequence entries, part 1677. 1641. gbinv1678.seq - Invertebrate sequence entries, part 1678. 1642. gbinv1679.seq - Invertebrate sequence entries, part 1679. 1643. gbinv168.seq - Invertebrate sequence entries, part 168. 1644. gbinv1680.seq - Invertebrate sequence entries, part 1680. 1645. gbinv1681.seq - Invertebrate sequence entries, part 1681. 1646. gbinv1682.seq - Invertebrate sequence entries, part 1682. 1647. gbinv1683.seq - Invertebrate sequence entries, part 1683. 1648. gbinv1684.seq - Invertebrate sequence entries, part 1684. 1649. gbinv1685.seq - Invertebrate sequence entries, part 1685. 1650. gbinv1686.seq - Invertebrate sequence entries, part 1686. 1651. gbinv1687.seq - Invertebrate sequence entries, part 1687. 1652. gbinv1688.seq - Invertebrate sequence entries, part 1688. 1653. gbinv1689.seq - Invertebrate sequence entries, part 1689. 1654. gbinv169.seq - Invertebrate sequence entries, part 169. 1655. gbinv1690.seq - Invertebrate sequence entries, part 1690. 1656. gbinv1691.seq - Invertebrate sequence entries, part 1691. 1657. gbinv1692.seq - Invertebrate sequence entries, part 1692. 1658. gbinv1693.seq - Invertebrate sequence entries, part 1693. 1659. gbinv1694.seq - Invertebrate sequence entries, part 1694. 1660. gbinv1695.seq - Invertebrate sequence entries, part 1695. 1661. gbinv1696.seq - Invertebrate sequence entries, part 1696. 1662. gbinv1697.seq - Invertebrate sequence entries, part 1697. 1663. gbinv1698.seq - Invertebrate sequence entries, part 1698. 1664. gbinv1699.seq - Invertebrate sequence entries, part 1699. 1665. gbinv17.seq - Invertebrate sequence entries, part 17. 1666. gbinv170.seq - Invertebrate sequence entries, part 170. 1667. gbinv1700.seq - Invertebrate sequence entries, part 1700. 1668. gbinv1701.seq - Invertebrate sequence entries, part 1701. 1669. gbinv1702.seq - Invertebrate sequence entries, part 1702. 1670. gbinv1703.seq - Invertebrate sequence entries, part 1703. 1671. gbinv1704.seq - Invertebrate sequence entries, part 1704. 1672. gbinv1705.seq - Invertebrate sequence entries, part 1705. 1673. gbinv1706.seq - Invertebrate sequence entries, part 1706. 1674. gbinv1707.seq - Invertebrate sequence entries, part 1707. 1675. gbinv1708.seq - Invertebrate sequence entries, part 1708. 1676. gbinv1709.seq - Invertebrate sequence entries, part 1709. 1677. gbinv171.seq - Invertebrate sequence entries, part 171. 1678. gbinv1710.seq - Invertebrate sequence entries, part 1710. 1679. gbinv1711.seq - Invertebrate sequence entries, part 1711. 1680. gbinv1712.seq - Invertebrate sequence entries, part 1712. 1681. gbinv1713.seq - Invertebrate sequence entries, part 1713. 1682. gbinv1714.seq - Invertebrate sequence entries, part 1714. 1683. gbinv1715.seq - Invertebrate sequence entries, part 1715. 1684. gbinv1716.seq - Invertebrate sequence entries, part 1716. 1685. gbinv1717.seq - Invertebrate sequence entries, part 1717. 1686. gbinv1718.seq - Invertebrate sequence entries, part 1718. 1687. gbinv1719.seq - Invertebrate sequence entries, part 1719. 1688. gbinv172.seq - Invertebrate sequence entries, part 172. 1689. gbinv1720.seq - Invertebrate sequence entries, part 1720. 1690. gbinv1721.seq - Invertebrate sequence entries, part 1721. 1691. gbinv1722.seq - Invertebrate sequence entries, part 1722. 1692. gbinv1723.seq - Invertebrate sequence entries, part 1723. 1693. gbinv1724.seq - Invertebrate sequence entries, part 1724. 1694. gbinv1725.seq - Invertebrate sequence entries, part 1725. 1695. gbinv1726.seq - Invertebrate sequence entries, part 1726. 1696. gbinv1727.seq - Invertebrate sequence entries, part 1727. 1697. gbinv1728.seq - Invertebrate sequence entries, part 1728. 1698. gbinv1729.seq - Invertebrate sequence entries, part 1729. 1699. gbinv173.seq - Invertebrate sequence entries, part 173. 1700. gbinv1730.seq - Invertebrate sequence entries, part 1730. 1701. gbinv1731.seq - Invertebrate sequence entries, part 1731. 1702. gbinv1732.seq - Invertebrate sequence entries, part 1732. 1703. gbinv1733.seq - Invertebrate sequence entries, part 1733. 1704. gbinv1734.seq - Invertebrate sequence entries, part 1734. 1705. gbinv1735.seq - Invertebrate sequence entries, part 1735. 1706. gbinv1736.seq - Invertebrate sequence entries, part 1736. 1707. gbinv1737.seq - Invertebrate sequence entries, part 1737. 1708. gbinv1738.seq - Invertebrate sequence entries, part 1738. 1709. gbinv1739.seq - Invertebrate sequence entries, part 1739. 1710. gbinv174.seq - Invertebrate sequence entries, part 174. 1711. gbinv1740.seq - Invertebrate sequence entries, part 1740. 1712. gbinv1741.seq - Invertebrate sequence entries, part 1741. 1713. gbinv1742.seq - Invertebrate sequence entries, part 1742. 1714. gbinv1743.seq - Invertebrate sequence entries, part 1743. 1715. gbinv1744.seq - Invertebrate sequence entries, part 1744. 1716. gbinv1745.seq - Invertebrate sequence entries, part 1745. 1717. gbinv1746.seq - Invertebrate sequence entries, part 1746. 1718. gbinv1747.seq - Invertebrate sequence entries, part 1747. 1719. gbinv1748.seq - Invertebrate sequence entries, part 1748. 1720. gbinv1749.seq - Invertebrate sequence entries, part 1749. 1721. gbinv175.seq - Invertebrate sequence entries, part 175. 1722. gbinv1750.seq - Invertebrate sequence entries, part 1750. 1723. gbinv1751.seq - Invertebrate sequence entries, part 1751. 1724. gbinv1752.seq - Invertebrate sequence entries, part 1752. 1725. gbinv1753.seq - Invertebrate sequence entries, part 1753. 1726. gbinv1754.seq - Invertebrate sequence entries, part 1754. 1727. gbinv1755.seq - Invertebrate sequence entries, part 1755. 1728. gbinv1756.seq - Invertebrate sequence entries, part 1756. 1729. gbinv1757.seq - Invertebrate sequence entries, part 1757. 1730. gbinv1758.seq - Invertebrate sequence entries, part 1758. 1731. gbinv1759.seq - Invertebrate sequence entries, part 1759. 1732. gbinv176.seq - Invertebrate sequence entries, part 176. 1733. gbinv1760.seq - Invertebrate sequence entries, part 1760. 1734. gbinv1761.seq - Invertebrate sequence entries, part 1761. 1735. gbinv1762.seq - Invertebrate sequence entries, part 1762. 1736. gbinv1763.seq - Invertebrate sequence entries, part 1763. 1737. gbinv1764.seq - Invertebrate sequence entries, part 1764. 1738. gbinv1765.seq - Invertebrate sequence entries, part 1765. 1739. gbinv1766.seq - Invertebrate sequence entries, part 1766. 1740. gbinv1767.seq - Invertebrate sequence entries, part 1767. 1741. gbinv1768.seq - Invertebrate sequence entries, part 1768. 1742. gbinv1769.seq - Invertebrate sequence entries, part 1769. 1743. gbinv177.seq - Invertebrate sequence entries, part 177. 1744. gbinv1770.seq - Invertebrate sequence entries, part 1770. 1745. gbinv1771.seq - Invertebrate sequence entries, part 1771. 1746. gbinv1772.seq - Invertebrate sequence entries, part 1772. 1747. gbinv1773.seq - Invertebrate sequence entries, part 1773. 1748. gbinv1774.seq - Invertebrate sequence entries, part 1774. 1749. gbinv1775.seq - Invertebrate sequence entries, part 1775. 1750. gbinv1776.seq - Invertebrate sequence entries, part 1776. 1751. gbinv1777.seq - Invertebrate sequence entries, part 1777. 1752. gbinv1778.seq - Invertebrate sequence entries, part 1778. 1753. gbinv1779.seq - Invertebrate sequence entries, part 1779. 1754. gbinv178.seq - Invertebrate sequence entries, part 178. 1755. gbinv1780.seq - Invertebrate sequence entries, part 1780. 1756. gbinv1781.seq - Invertebrate sequence entries, part 1781. 1757. gbinv1782.seq - Invertebrate sequence entries, part 1782. 1758. gbinv1783.seq - Invertebrate sequence entries, part 1783. 1759. gbinv1784.seq - Invertebrate sequence entries, part 1784. 1760. gbinv1785.seq - Invertebrate sequence entries, part 1785. 1761. gbinv1786.seq - Invertebrate sequence entries, part 1786. 1762. gbinv1787.seq - Invertebrate sequence entries, part 1787. 1763. gbinv1788.seq - Invertebrate sequence entries, part 1788. 1764. gbinv1789.seq - Invertebrate sequence entries, part 1789. 1765. gbinv179.seq - Invertebrate sequence entries, part 179. 1766. gbinv1790.seq - Invertebrate sequence entries, part 1790. 1767. gbinv1791.seq - Invertebrate sequence entries, part 1791. 1768. gbinv1792.seq - Invertebrate sequence entries, part 1792. 1769. gbinv1793.seq - Invertebrate sequence entries, part 1793. 1770. gbinv1794.seq - Invertebrate sequence entries, part 1794. 1771. gbinv1795.seq - Invertebrate sequence entries, part 1795. 1772. gbinv1796.seq - Invertebrate sequence entries, part 1796. 1773. gbinv1797.seq - Invertebrate sequence entries, part 1797. 1774. gbinv1798.seq - Invertebrate sequence entries, part 1798. 1775. gbinv1799.seq - Invertebrate sequence entries, part 1799. 1776. gbinv18.seq - Invertebrate sequence entries, part 18. 1777. gbinv180.seq - Invertebrate sequence entries, part 180. 1778. gbinv1800.seq - Invertebrate sequence entries, part 1800. 1779. gbinv1801.seq - Invertebrate sequence entries, part 1801. 1780. gbinv1802.seq - Invertebrate sequence entries, part 1802. 1781. gbinv1803.seq - Invertebrate sequence entries, part 1803. 1782. gbinv1804.seq - Invertebrate sequence entries, part 1804. 1783. gbinv1805.seq - Invertebrate sequence entries, part 1805. 1784. gbinv1806.seq - Invertebrate sequence entries, part 1806. 1785. gbinv1807.seq - Invertebrate sequence entries, part 1807. 1786. gbinv1808.seq - Invertebrate sequence entries, part 1808. 1787. gbinv1809.seq - Invertebrate sequence entries, part 1809. 1788. gbinv181.seq - Invertebrate sequence entries, part 181. 1789. gbinv1810.seq - Invertebrate sequence entries, part 1810. 1790. gbinv1811.seq - Invertebrate sequence entries, part 1811. 1791. gbinv1812.seq - Invertebrate sequence entries, part 1812. 1792. gbinv1813.seq - Invertebrate sequence entries, part 1813. 1793. gbinv1814.seq - Invertebrate sequence entries, part 1814. 1794. gbinv1815.seq - Invertebrate sequence entries, part 1815. 1795. gbinv1816.seq - Invertebrate sequence entries, part 1816. 1796. gbinv1817.seq - Invertebrate sequence entries, part 1817. 1797. gbinv1818.seq - Invertebrate sequence entries, part 1818. 1798. gbinv1819.seq - Invertebrate sequence entries, part 1819. 1799. gbinv182.seq - Invertebrate sequence entries, part 182. 1800. gbinv1820.seq - Invertebrate sequence entries, part 1820. 1801. gbinv1821.seq - Invertebrate sequence entries, part 1821. 1802. gbinv1822.seq - Invertebrate sequence entries, part 1822. 1803. gbinv1823.seq - Invertebrate sequence entries, part 1823. 1804. gbinv1824.seq - Invertebrate sequence entries, part 1824. 1805. gbinv1825.seq - Invertebrate sequence entries, part 1825. 1806. gbinv1826.seq - Invertebrate sequence entries, part 1826. 1807. gbinv1827.seq - Invertebrate sequence entries, part 1827. 1808. gbinv1828.seq - Invertebrate sequence entries, part 1828. 1809. gbinv1829.seq - Invertebrate sequence entries, part 1829. 1810. gbinv183.seq - Invertebrate sequence entries, part 183. 1811. gbinv1830.seq - Invertebrate sequence entries, part 1830. 1812. gbinv1831.seq - Invertebrate sequence entries, part 1831. 1813. gbinv1832.seq - Invertebrate sequence entries, part 1832. 1814. gbinv1833.seq - Invertebrate sequence entries, part 1833. 1815. gbinv1834.seq - Invertebrate sequence entries, part 1834. 1816. gbinv1835.seq - Invertebrate sequence entries, part 1835. 1817. gbinv1836.seq - Invertebrate sequence entries, part 1836. 1818. gbinv1837.seq - Invertebrate sequence entries, part 1837. 1819. gbinv1838.seq - Invertebrate sequence entries, part 1838. 1820. gbinv1839.seq - Invertebrate sequence entries, part 1839. 1821. gbinv184.seq - Invertebrate sequence entries, part 184. 1822. gbinv1840.seq - Invertebrate sequence entries, part 1840. 1823. gbinv1841.seq - Invertebrate sequence entries, part 1841. 1824. gbinv1842.seq - Invertebrate sequence entries, part 1842. 1825. gbinv1843.seq - Invertebrate sequence entries, part 1843. 1826. gbinv1844.seq - Invertebrate sequence entries, part 1844. 1827. gbinv1845.seq - Invertebrate sequence entries, part 1845. 1828. gbinv1846.seq - Invertebrate sequence entries, part 1846. 1829. gbinv1847.seq - Invertebrate sequence entries, part 1847. 1830. gbinv1848.seq - Invertebrate sequence entries, part 1848. 1831. gbinv1849.seq - Invertebrate sequence entries, part 1849. 1832. gbinv185.seq - Invertebrate sequence entries, part 185. 1833. gbinv1850.seq - Invertebrate sequence entries, part 1850. 1834. gbinv1851.seq - Invertebrate sequence entries, part 1851. 1835. gbinv1852.seq - Invertebrate sequence entries, part 1852. 1836. gbinv1853.seq - Invertebrate sequence entries, part 1853. 1837. gbinv1854.seq - Invertebrate sequence entries, part 1854. 1838. gbinv1855.seq - Invertebrate sequence entries, part 1855. 1839. gbinv1856.seq - Invertebrate sequence entries, part 1856. 1840. gbinv1857.seq - Invertebrate sequence entries, part 1857. 1841. gbinv1858.seq - Invertebrate sequence entries, part 1858. 1842. gbinv1859.seq - Invertebrate sequence entries, part 1859. 1843. gbinv186.seq - Invertebrate sequence entries, part 186. 1844. gbinv1860.seq - Invertebrate sequence entries, part 1860. 1845. gbinv1861.seq - Invertebrate sequence entries, part 1861. 1846. gbinv1862.seq - Invertebrate sequence entries, part 1862. 1847. gbinv1863.seq - Invertebrate sequence entries, part 1863. 1848. gbinv1864.seq - Invertebrate sequence entries, part 1864. 1849. gbinv1865.seq - Invertebrate sequence entries, part 1865. 1850. gbinv1866.seq - Invertebrate sequence entries, part 1866. 1851. gbinv1867.seq - Invertebrate sequence entries, part 1867. 1852. gbinv1868.seq - Invertebrate sequence entries, part 1868. 1853. gbinv1869.seq - Invertebrate sequence entries, part 1869. 1854. gbinv187.seq - Invertebrate sequence entries, part 187. 1855. gbinv1870.seq - Invertebrate sequence entries, part 1870. 1856. gbinv1871.seq - Invertebrate sequence entries, part 1871. 1857. gbinv1872.seq - Invertebrate sequence entries, part 1872. 1858. gbinv1873.seq - Invertebrate sequence entries, part 1873. 1859. gbinv1874.seq - Invertebrate sequence entries, part 1874. 1860. gbinv1875.seq - Invertebrate sequence entries, part 1875. 1861. gbinv1876.seq - Invertebrate sequence entries, part 1876. 1862. gbinv1877.seq - Invertebrate sequence entries, part 1877. 1863. gbinv1878.seq - Invertebrate sequence entries, part 1878. 1864. gbinv1879.seq - Invertebrate sequence entries, part 1879. 1865. gbinv188.seq - Invertebrate sequence entries, part 188. 1866. gbinv1880.seq - Invertebrate sequence entries, part 1880. 1867. gbinv1881.seq - Invertebrate sequence entries, part 1881. 1868. gbinv1882.seq - Invertebrate sequence entries, part 1882. 1869. gbinv1883.seq - Invertebrate sequence entries, part 1883. 1870. gbinv1884.seq - Invertebrate sequence entries, part 1884. 1871. gbinv1885.seq - Invertebrate sequence entries, part 1885. 1872. gbinv1886.seq - Invertebrate sequence entries, part 1886. 1873. gbinv1887.seq - Invertebrate sequence entries, part 1887. 1874. gbinv1888.seq - Invertebrate sequence entries, part 1888. 1875. gbinv1889.seq - Invertebrate sequence entries, part 1889. 1876. gbinv189.seq - Invertebrate sequence entries, part 189. 1877. gbinv1890.seq - Invertebrate sequence entries, part 1890. 1878. gbinv1891.seq - Invertebrate sequence entries, part 1891. 1879. gbinv1892.seq - Invertebrate sequence entries, part 1892. 1880. gbinv1893.seq - Invertebrate sequence entries, part 1893. 1881. gbinv1894.seq - Invertebrate sequence entries, part 1894. 1882. gbinv1895.seq - Invertebrate sequence entries, part 1895. 1883. gbinv1896.seq - Invertebrate sequence entries, part 1896. 1884. gbinv1897.seq - Invertebrate sequence entries, part 1897. 1885. gbinv1898.seq - Invertebrate sequence entries, part 1898. 1886. gbinv1899.seq - Invertebrate sequence entries, part 1899. 1887. gbinv19.seq - Invertebrate sequence entries, part 19. 1888. gbinv190.seq - Invertebrate sequence entries, part 190. 1889. gbinv1900.seq - Invertebrate sequence entries, part 1900. 1890. gbinv1901.seq - Invertebrate sequence entries, part 1901. 1891. gbinv1902.seq - Invertebrate sequence entries, part 1902. 1892. gbinv1903.seq - Invertebrate sequence entries, part 1903. 1893. gbinv1904.seq - Invertebrate sequence entries, part 1904. 1894. gbinv1905.seq - Invertebrate sequence entries, part 1905. 1895. gbinv1906.seq - Invertebrate sequence entries, part 1906. 1896. gbinv1907.seq - Invertebrate sequence entries, part 1907. 1897. gbinv1908.seq - Invertebrate sequence entries, part 1908. 1898. gbinv1909.seq - Invertebrate sequence entries, part 1909. 1899. gbinv191.seq - Invertebrate sequence entries, part 191. 1900. gbinv1910.seq - Invertebrate sequence entries, part 1910. 1901. gbinv1911.seq - Invertebrate sequence entries, part 1911. 1902. gbinv1912.seq - Invertebrate sequence entries, part 1912. 1903. gbinv1913.seq - Invertebrate sequence entries, part 1913. 1904. gbinv1914.seq - Invertebrate sequence entries, part 1914. 1905. gbinv1915.seq - Invertebrate sequence entries, part 1915. 1906. gbinv1916.seq - Invertebrate sequence entries, part 1916. 1907. gbinv1917.seq - Invertebrate sequence entries, part 1917. 1908. gbinv1918.seq - Invertebrate sequence entries, part 1918. 1909. gbinv1919.seq - Invertebrate sequence entries, part 1919. 1910. gbinv192.seq - Invertebrate sequence entries, part 192. 1911. gbinv1920.seq - Invertebrate sequence entries, part 1920. 1912. gbinv1921.seq - Invertebrate sequence entries, part 1921. 1913. gbinv1922.seq - Invertebrate sequence entries, part 1922. 1914. gbinv1923.seq - Invertebrate sequence entries, part 1923. 1915. gbinv1924.seq - Invertebrate sequence entries, part 1924. 1916. gbinv1925.seq - Invertebrate sequence entries, part 1925. 1917. gbinv1926.seq - Invertebrate sequence entries, part 1926. 1918. gbinv1927.seq - Invertebrate sequence entries, part 1927. 1919. gbinv1928.seq - Invertebrate sequence entries, part 1928. 1920. gbinv1929.seq - Invertebrate sequence entries, part 1929. 1921. gbinv193.seq - Invertebrate sequence entries, part 193. 1922. gbinv1930.seq - Invertebrate sequence entries, part 1930. 1923. gbinv1931.seq - Invertebrate sequence entries, part 1931. 1924. gbinv1932.seq - Invertebrate sequence entries, part 1932. 1925. gbinv1933.seq - Invertebrate sequence entries, part 1933. 1926. gbinv1934.seq - Invertebrate sequence entries, part 1934. 1927. gbinv1935.seq - Invertebrate sequence entries, part 1935. 1928. gbinv1936.seq - Invertebrate sequence entries, part 1936. 1929. gbinv1937.seq - Invertebrate sequence entries, part 1937. 1930. gbinv1938.seq - Invertebrate sequence entries, part 1938. 1931. gbinv1939.seq - Invertebrate sequence entries, part 1939. 1932. gbinv194.seq - Invertebrate sequence entries, part 194. 1933. gbinv1940.seq - Invertebrate sequence entries, part 1940. 1934. gbinv1941.seq - Invertebrate sequence entries, part 1941. 1935. gbinv1942.seq - Invertebrate sequence entries, part 1942. 1936. gbinv1943.seq - Invertebrate sequence entries, part 1943. 1937. gbinv1944.seq - Invertebrate sequence entries, part 1944. 1938. gbinv1945.seq - Invertebrate sequence entries, part 1945. 1939. gbinv1946.seq - Invertebrate sequence entries, part 1946. 1940. gbinv1947.seq - Invertebrate sequence entries, part 1947. 1941. gbinv1948.seq - Invertebrate sequence entries, part 1948. 1942. gbinv1949.seq - Invertebrate sequence entries, part 1949. 1943. gbinv195.seq - Invertebrate sequence entries, part 195. 1944. gbinv1950.seq - Invertebrate sequence entries, part 1950. 1945. gbinv1951.seq - Invertebrate sequence entries, part 1951. 1946. gbinv1952.seq - Invertebrate sequence entries, part 1952. 1947. gbinv1953.seq - Invertebrate sequence entries, part 1953. 1948. gbinv1954.seq - Invertebrate sequence entries, part 1954. 1949. gbinv1955.seq - Invertebrate sequence entries, part 1955. 1950. gbinv1956.seq - Invertebrate sequence entries, part 1956. 1951. gbinv1957.seq - Invertebrate sequence entries, part 1957. 1952. gbinv1958.seq - Invertebrate sequence entries, part 1958. 1953. gbinv1959.seq - Invertebrate sequence entries, part 1959. 1954. gbinv196.seq - Invertebrate sequence entries, part 196. 1955. gbinv1960.seq - Invertebrate sequence entries, part 1960. 1956. gbinv1961.seq - Invertebrate sequence entries, part 1961. 1957. gbinv1962.seq - Invertebrate sequence entries, part 1962. 1958. gbinv1963.seq - Invertebrate sequence entries, part 1963. 1959. gbinv1964.seq - Invertebrate sequence entries, part 1964. 1960. gbinv1965.seq - Invertebrate sequence entries, part 1965. 1961. gbinv1966.seq - Invertebrate sequence entries, part 1966. 1962. gbinv1967.seq - Invertebrate sequence entries, part 1967. 1963. gbinv1968.seq - Invertebrate sequence entries, part 1968. 1964. gbinv1969.seq - Invertebrate sequence entries, part 1969. 1965. gbinv197.seq - Invertebrate sequence entries, part 197. 1966. gbinv1970.seq - Invertebrate sequence entries, part 1970. 1967. gbinv1971.seq - Invertebrate sequence entries, part 1971. 1968. gbinv1972.seq - Invertebrate sequence entries, part 1972. 1969. gbinv1973.seq - Invertebrate sequence entries, part 1973. 1970. gbinv1974.seq - Invertebrate sequence entries, part 1974. 1971. gbinv1975.seq - Invertebrate sequence entries, part 1975. 1972. gbinv1976.seq - Invertebrate sequence entries, part 1976. 1973. gbinv1977.seq - Invertebrate sequence entries, part 1977. 1974. gbinv1978.seq - Invertebrate sequence entries, part 1978. 1975. gbinv1979.seq - Invertebrate sequence entries, part 1979. 1976. gbinv198.seq - Invertebrate sequence entries, part 198. 1977. gbinv1980.seq - Invertebrate sequence entries, part 1980. 1978. gbinv1981.seq - Invertebrate sequence entries, part 1981. 1979. gbinv1982.seq - Invertebrate sequence entries, part 1982. 1980. gbinv1983.seq - Invertebrate sequence entries, part 1983. 1981. gbinv1984.seq - Invertebrate sequence entries, part 1984. 1982. gbinv1985.seq - Invertebrate sequence entries, part 1985. 1983. gbinv1986.seq - Invertebrate sequence entries, part 1986. 1984. gbinv1987.seq - Invertebrate sequence entries, part 1987. 1985. gbinv1988.seq - Invertebrate sequence entries, part 1988. 1986. gbinv1989.seq - Invertebrate sequence entries, part 1989. 1987. gbinv199.seq - Invertebrate sequence entries, part 199. 1988. gbinv1990.seq - Invertebrate sequence entries, part 1990. 1989. gbinv1991.seq - Invertebrate sequence entries, part 1991. 1990. gbinv1992.seq - Invertebrate sequence entries, part 1992. 1991. gbinv1993.seq - Invertebrate sequence entries, part 1993. 1992. gbinv1994.seq - Invertebrate sequence entries, part 1994. 1993. gbinv1995.seq - Invertebrate sequence entries, part 1995. 1994. gbinv1996.seq - Invertebrate sequence entries, part 1996. 1995. gbinv1997.seq - Invertebrate sequence entries, part 1997. 1996. gbinv1998.seq - Invertebrate sequence entries, part 1998. 1997. gbinv1999.seq - Invertebrate sequence entries, part 1999. 1998. gbinv2.seq - Invertebrate sequence entries, part 2. 1999. gbinv20.seq - Invertebrate sequence entries, part 20. 2000. gbinv200.seq - Invertebrate sequence entries, part 200. 2001. gbinv2000.seq - Invertebrate sequence entries, part 2000. 2002. gbinv2001.seq - Invertebrate sequence entries, part 2001. 2003. gbinv2002.seq - Invertebrate sequence entries, part 2002. 2004. gbinv2003.seq - Invertebrate sequence entries, part 2003. 2005. gbinv2004.seq - Invertebrate sequence entries, part 2004. 2006. gbinv2005.seq - Invertebrate sequence entries, part 2005. 2007. gbinv2006.seq - Invertebrate sequence entries, part 2006. 2008. gbinv2007.seq - Invertebrate sequence entries, part 2007. 2009. gbinv2008.seq - Invertebrate sequence entries, part 2008. 2010. gbinv2009.seq - Invertebrate sequence entries, part 2009. 2011. gbinv201.seq - Invertebrate sequence entries, part 201. 2012. gbinv2010.seq - Invertebrate sequence entries, part 2010. 2013. gbinv2011.seq - Invertebrate sequence entries, part 2011. 2014. gbinv2012.seq - Invertebrate sequence entries, part 2012. 2015. gbinv2013.seq - Invertebrate sequence entries, part 2013. 2016. gbinv2014.seq - Invertebrate sequence entries, part 2014. 2017. gbinv2015.seq - Invertebrate sequence entries, part 2015. 2018. gbinv2016.seq - Invertebrate sequence entries, part 2016. 2019. gbinv2017.seq - Invertebrate sequence entries, part 2017. 2020. gbinv2018.seq - Invertebrate sequence entries, part 2018. 2021. gbinv2019.seq - Invertebrate sequence entries, part 2019. 2022. gbinv202.seq - Invertebrate sequence entries, part 202. 2023. gbinv2020.seq - Invertebrate sequence entries, part 2020. 2024. gbinv2021.seq - Invertebrate sequence entries, part 2021. 2025. gbinv2022.seq - Invertebrate sequence entries, part 2022. 2026. gbinv2023.seq - Invertebrate sequence entries, part 2023. 2027. gbinv2024.seq - Invertebrate sequence entries, part 2024. 2028. gbinv2025.seq - Invertebrate sequence entries, part 2025. 2029. gbinv2026.seq - Invertebrate sequence entries, part 2026. 2030. gbinv2027.seq - Invertebrate sequence entries, part 2027. 2031. gbinv2028.seq - Invertebrate sequence entries, part 2028. 2032. gbinv2029.seq - Invertebrate sequence entries, part 2029. 2033. gbinv203.seq - Invertebrate sequence entries, part 203. 2034. gbinv2030.seq - Invertebrate sequence entries, part 2030. 2035. gbinv2031.seq - Invertebrate sequence entries, part 2031. 2036. gbinv2032.seq - Invertebrate sequence entries, part 2032. 2037. gbinv2033.seq - Invertebrate sequence entries, part 2033. 2038. gbinv2034.seq - Invertebrate sequence entries, part 2034. 2039. gbinv2035.seq - Invertebrate sequence entries, part 2035. 2040. gbinv2036.seq - Invertebrate sequence entries, part 2036. 2041. gbinv2037.seq - Invertebrate sequence entries, part 2037. 2042. gbinv2038.seq - Invertebrate sequence entries, part 2038. 2043. gbinv2039.seq - Invertebrate sequence entries, part 2039. 2044. gbinv204.seq - Invertebrate sequence entries, part 204. 2045. gbinv2040.seq - Invertebrate sequence entries, part 2040. 2046. gbinv2041.seq - Invertebrate sequence entries, part 2041. 2047. gbinv2042.seq - Invertebrate sequence entries, part 2042. 2048. gbinv2043.seq - Invertebrate sequence entries, part 2043. 2049. gbinv2044.seq - Invertebrate sequence entries, part 2044. 2050. gbinv2045.seq - Invertebrate sequence entries, part 2045. 2051. gbinv2046.seq - Invertebrate sequence entries, part 2046. 2052. gbinv2047.seq - Invertebrate sequence entries, part 2047. 2053. gbinv2048.seq - Invertebrate sequence entries, part 2048. 2054. gbinv2049.seq - Invertebrate sequence entries, part 2049. 2055. gbinv205.seq - Invertebrate sequence entries, part 205. 2056. gbinv2050.seq - Invertebrate sequence entries, part 2050. 2057. gbinv2051.seq - Invertebrate sequence entries, part 2051. 2058. gbinv2052.seq - Invertebrate sequence entries, part 2052. 2059. gbinv2053.seq - Invertebrate sequence entries, part 2053. 2060. gbinv2054.seq - Invertebrate sequence entries, part 2054. 2061. gbinv2055.seq - Invertebrate sequence entries, part 2055. 2062. gbinv2056.seq - Invertebrate sequence entries, part 2056. 2063. gbinv2057.seq - Invertebrate sequence entries, part 2057. 2064. gbinv2058.seq - Invertebrate sequence entries, part 2058. 2065. gbinv2059.seq - Invertebrate sequence entries, part 2059. 2066. gbinv206.seq - Invertebrate sequence entries, part 206. 2067. gbinv2060.seq - Invertebrate sequence entries, part 2060. 2068. gbinv2061.seq - Invertebrate sequence entries, part 2061. 2069. gbinv2062.seq - Invertebrate sequence entries, part 2062. 2070. gbinv2063.seq - Invertebrate sequence entries, part 2063. 2071. gbinv2064.seq - Invertebrate sequence entries, part 2064. 2072. gbinv2065.seq - Invertebrate sequence entries, part 2065. 2073. gbinv2066.seq - Invertebrate sequence entries, part 2066. 2074. gbinv2067.seq - Invertebrate sequence entries, part 2067. 2075. gbinv2068.seq - Invertebrate sequence entries, part 2068. 2076. gbinv2069.seq - Invertebrate sequence entries, part 2069. 2077. gbinv207.seq - Invertebrate sequence entries, part 207. 2078. gbinv2070.seq - Invertebrate sequence entries, part 2070. 2079. gbinv2071.seq - Invertebrate sequence entries, part 2071. 2080. gbinv2072.seq - Invertebrate sequence entries, part 2072. 2081. gbinv2073.seq - Invertebrate sequence entries, part 2073. 2082. gbinv2074.seq - Invertebrate sequence entries, part 2074. 2083. gbinv2075.seq - Invertebrate sequence entries, part 2075. 2084. gbinv2076.seq - Invertebrate sequence entries, part 2076. 2085. gbinv2077.seq - Invertebrate sequence entries, part 2077. 2086. gbinv2078.seq - Invertebrate sequence entries, part 2078. 2087. gbinv2079.seq - Invertebrate sequence entries, part 2079. 2088. gbinv208.seq - Invertebrate sequence entries, part 208. 2089. gbinv2080.seq - Invertebrate sequence entries, part 2080. 2090. gbinv2081.seq - Invertebrate sequence entries, part 2081. 2091. gbinv2082.seq - Invertebrate sequence entries, part 2082. 2092. gbinv2083.seq - Invertebrate sequence entries, part 2083. 2093. gbinv2084.seq - Invertebrate sequence entries, part 2084. 2094. gbinv2085.seq - Invertebrate sequence entries, part 2085. 2095. gbinv2086.seq - Invertebrate sequence entries, part 2086. 2096. gbinv2087.seq - Invertebrate sequence entries, part 2087. 2097. gbinv2088.seq - Invertebrate sequence entries, part 2088. 2098. gbinv2089.seq - Invertebrate sequence entries, part 2089. 2099. gbinv209.seq - Invertebrate sequence entries, part 209. 2100. gbinv2090.seq - Invertebrate sequence entries, part 2090. 2101. gbinv2091.seq - Invertebrate sequence entries, part 2091. 2102. gbinv2092.seq - Invertebrate sequence entries, part 2092. 2103. gbinv2093.seq - Invertebrate sequence entries, part 2093. 2104. gbinv2094.seq - Invertebrate sequence entries, part 2094. 2105. gbinv2095.seq - Invertebrate sequence entries, part 2095. 2106. gbinv2096.seq - Invertebrate sequence entries, part 2096. 2107. gbinv2097.seq - Invertebrate sequence entries, part 2097. 2108. gbinv2098.seq - Invertebrate sequence entries, part 2098. 2109. gbinv2099.seq - Invertebrate sequence entries, part 2099. 2110. gbinv21.seq - Invertebrate sequence entries, part 21. 2111. gbinv210.seq - Invertebrate sequence entries, part 210. 2112. gbinv2100.seq - Invertebrate sequence entries, part 2100. 2113. gbinv2101.seq - Invertebrate sequence entries, part 2101. 2114. gbinv2102.seq - Invertebrate sequence entries, part 2102. 2115. gbinv2103.seq - Invertebrate sequence entries, part 2103. 2116. gbinv2104.seq - Invertebrate sequence entries, part 2104. 2117. gbinv2105.seq - Invertebrate sequence entries, part 2105. 2118. gbinv2106.seq - Invertebrate sequence entries, part 2106. 2119. gbinv2107.seq - Invertebrate sequence entries, part 2107. 2120. gbinv2108.seq - Invertebrate sequence entries, part 2108. 2121. gbinv2109.seq - Invertebrate sequence entries, part 2109. 2122. gbinv211.seq - Invertebrate sequence entries, part 211. 2123. gbinv2110.seq - Invertebrate sequence entries, part 2110. 2124. gbinv2111.seq - Invertebrate sequence entries, part 2111. 2125. gbinv2112.seq - Invertebrate sequence entries, part 2112. 2126. gbinv2113.seq - Invertebrate sequence entries, part 2113. 2127. gbinv2114.seq - Invertebrate sequence entries, part 2114. 2128. gbinv2115.seq - Invertebrate sequence entries, part 2115. 2129. gbinv2116.seq - Invertebrate sequence entries, part 2116. 2130. gbinv2117.seq - Invertebrate sequence entries, part 2117. 2131. gbinv2118.seq - Invertebrate sequence entries, part 2118. 2132. gbinv2119.seq - Invertebrate sequence entries, part 2119. 2133. gbinv212.seq - Invertebrate sequence entries, part 212. 2134. gbinv2120.seq - Invertebrate sequence entries, part 2120. 2135. gbinv2121.seq - Invertebrate sequence entries, part 2121. 2136. gbinv2122.seq - Invertebrate sequence entries, part 2122. 2137. gbinv2123.seq - Invertebrate sequence entries, part 2123. 2138. gbinv2124.seq - Invertebrate sequence entries, part 2124. 2139. gbinv2125.seq - Invertebrate sequence entries, part 2125. 2140. gbinv2126.seq - Invertebrate sequence entries, part 2126. 2141. gbinv2127.seq - Invertebrate sequence entries, part 2127. 2142. gbinv2128.seq - Invertebrate sequence entries, part 2128. 2143. gbinv2129.seq - Invertebrate sequence entries, part 2129. 2144. gbinv213.seq - Invertebrate sequence entries, part 213. 2145. gbinv2130.seq - Invertebrate sequence entries, part 2130. 2146. gbinv2131.seq - Invertebrate sequence entries, part 2131. 2147. gbinv2132.seq - Invertebrate sequence entries, part 2132. 2148. gbinv2133.seq - Invertebrate sequence entries, part 2133. 2149. gbinv2134.seq - Invertebrate sequence entries, part 2134. 2150. gbinv2135.seq - Invertebrate sequence entries, part 2135. 2151. gbinv2136.seq - Invertebrate sequence entries, part 2136. 2152. gbinv2137.seq - Invertebrate sequence entries, part 2137. 2153. gbinv2138.seq - Invertebrate sequence entries, part 2138. 2154. gbinv2139.seq - Invertebrate sequence entries, part 2139. 2155. gbinv214.seq - Invertebrate sequence entries, part 214. 2156. gbinv2140.seq - Invertebrate sequence entries, part 2140. 2157. gbinv2141.seq - Invertebrate sequence entries, part 2141. 2158. gbinv2142.seq - Invertebrate sequence entries, part 2142. 2159. gbinv2143.seq - Invertebrate sequence entries, part 2143. 2160. gbinv2144.seq - Invertebrate sequence entries, part 2144. 2161. gbinv2145.seq - Invertebrate sequence entries, part 2145. 2162. gbinv2146.seq - Invertebrate sequence entries, part 2146. 2163. gbinv2147.seq - Invertebrate sequence entries, part 2147. 2164. gbinv2148.seq - Invertebrate sequence entries, part 2148. 2165. gbinv2149.seq - Invertebrate sequence entries, part 2149. 2166. gbinv215.seq - Invertebrate sequence entries, part 215. 2167. gbinv2150.seq - Invertebrate sequence entries, part 2150. 2168. gbinv2151.seq - Invertebrate sequence entries, part 2151. 2169. gbinv2152.seq - Invertebrate sequence entries, part 2152. 2170. gbinv2153.seq - Invertebrate sequence entries, part 2153. 2171. gbinv2154.seq - Invertebrate sequence entries, part 2154. 2172. gbinv2155.seq - Invertebrate sequence entries, part 2155. 2173. gbinv2156.seq - Invertebrate sequence entries, part 2156. 2174. gbinv2157.seq - Invertebrate sequence entries, part 2157. 2175. gbinv2158.seq - Invertebrate sequence entries, part 2158. 2176. gbinv2159.seq - Invertebrate sequence entries, part 2159. 2177. gbinv216.seq - Invertebrate sequence entries, part 216. 2178. gbinv2160.seq - Invertebrate sequence entries, part 2160. 2179. gbinv2161.seq - Invertebrate sequence entries, part 2161. 2180. gbinv2162.seq - Invertebrate sequence entries, part 2162. 2181. gbinv2163.seq - Invertebrate sequence entries, part 2163. 2182. gbinv2164.seq - Invertebrate sequence entries, part 2164. 2183. gbinv2165.seq - Invertebrate sequence entries, part 2165. 2184. gbinv2166.seq - Invertebrate sequence entries, part 2166. 2185. gbinv2167.seq - Invertebrate sequence entries, part 2167. 2186. gbinv2168.seq - Invertebrate sequence entries, part 2168. 2187. gbinv2169.seq - Invertebrate sequence entries, part 2169. 2188. gbinv217.seq - Invertebrate sequence entries, part 217. 2189. gbinv2170.seq - Invertebrate sequence entries, part 2170. 2190. gbinv2171.seq - Invertebrate sequence entries, part 2171. 2191. gbinv2172.seq - Invertebrate sequence entries, part 2172. 2192. gbinv2173.seq - Invertebrate sequence entries, part 2173. 2193. gbinv2174.seq - Invertebrate sequence entries, part 2174. 2194. gbinv2175.seq - Invertebrate sequence entries, part 2175. 2195. gbinv2176.seq - Invertebrate sequence entries, part 2176. 2196. gbinv2177.seq - Invertebrate sequence entries, part 2177. 2197. gbinv2178.seq - Invertebrate sequence entries, part 2178. 2198. gbinv2179.seq - Invertebrate sequence entries, part 2179. 2199. gbinv218.seq - Invertebrate sequence entries, part 218. 2200. gbinv2180.seq - Invertebrate sequence entries, part 2180. 2201. gbinv2181.seq - Invertebrate sequence entries, part 2181. 2202. gbinv2182.seq - Invertebrate sequence entries, part 2182. 2203. gbinv2183.seq - Invertebrate sequence entries, part 2183. 2204. gbinv2184.seq - Invertebrate sequence entries, part 2184. 2205. gbinv2185.seq - Invertebrate sequence entries, part 2185. 2206. gbinv2186.seq - Invertebrate sequence entries, part 2186. 2207. gbinv2187.seq - Invertebrate sequence entries, part 2187. 2208. gbinv2188.seq - Invertebrate sequence entries, part 2188. 2209. gbinv2189.seq - Invertebrate sequence entries, part 2189. 2210. gbinv219.seq - Invertebrate sequence entries, part 219. 2211. gbinv2190.seq - Invertebrate sequence entries, part 2190. 2212. gbinv2191.seq - Invertebrate sequence entries, part 2191. 2213. gbinv2192.seq - Invertebrate sequence entries, part 2192. 2214. gbinv2193.seq - Invertebrate sequence entries, part 2193. 2215. gbinv2194.seq - Invertebrate sequence entries, part 2194. 2216. gbinv2195.seq - Invertebrate sequence entries, part 2195. 2217. gbinv2196.seq - Invertebrate sequence entries, part 2196. 2218. gbinv2197.seq - Invertebrate sequence entries, part 2197. 2219. gbinv2198.seq - Invertebrate sequence entries, part 2198. 2220. gbinv2199.seq - Invertebrate sequence entries, part 2199. 2221. gbinv22.seq - Invertebrate sequence entries, part 22. 2222. gbinv220.seq - Invertebrate sequence entries, part 220. 2223. gbinv2200.seq - Invertebrate sequence entries, part 2200. 2224. gbinv2201.seq - Invertebrate sequence entries, part 2201. 2225. gbinv2202.seq - Invertebrate sequence entries, part 2202. 2226. gbinv2203.seq - Invertebrate sequence entries, part 2203. 2227. gbinv2204.seq - Invertebrate sequence entries, part 2204. 2228. gbinv2205.seq - Invertebrate sequence entries, part 2205. 2229. gbinv2206.seq - Invertebrate sequence entries, part 2206. 2230. gbinv2207.seq - Invertebrate sequence entries, part 2207. 2231. gbinv2208.seq - Invertebrate sequence entries, part 2208. 2232. gbinv2209.seq - Invertebrate sequence entries, part 2209. 2233. gbinv221.seq - Invertebrate sequence entries, part 221. 2234. gbinv2210.seq - Invertebrate sequence entries, part 2210. 2235. gbinv2211.seq - Invertebrate sequence entries, part 2211. 2236. gbinv2212.seq - Invertebrate sequence entries, part 2212. 2237. gbinv2213.seq - Invertebrate sequence entries, part 2213. 2238. gbinv2214.seq - Invertebrate sequence entries, part 2214. 2239. gbinv2215.seq - Invertebrate sequence entries, part 2215. 2240. gbinv2216.seq - Invertebrate sequence entries, part 2216. 2241. gbinv2217.seq - Invertebrate sequence entries, part 2217. 2242. gbinv2218.seq - Invertebrate sequence entries, part 2218. 2243. gbinv2219.seq - Invertebrate sequence entries, part 2219. 2244. gbinv222.seq - Invertebrate sequence entries, part 222. 2245. gbinv2220.seq - Invertebrate sequence entries, part 2220. 2246. gbinv2221.seq - Invertebrate sequence entries, part 2221. 2247. gbinv2222.seq - Invertebrate sequence entries, part 2222. 2248. gbinv2223.seq - Invertebrate sequence entries, part 2223. 2249. gbinv2224.seq - Invertebrate sequence entries, part 2224. 2250. gbinv2225.seq - Invertebrate sequence entries, part 2225. 2251. gbinv2226.seq - Invertebrate sequence entries, part 2226. 2252. gbinv2227.seq - Invertebrate sequence entries, part 2227. 2253. gbinv2228.seq - Invertebrate sequence entries, part 2228. 2254. gbinv2229.seq - Invertebrate sequence entries, part 2229. 2255. gbinv223.seq - Invertebrate sequence entries, part 223. 2256. gbinv2230.seq - Invertebrate sequence entries, part 2230. 2257. gbinv2231.seq - Invertebrate sequence entries, part 2231. 2258. gbinv2232.seq - Invertebrate sequence entries, part 2232. 2259. gbinv2233.seq - Invertebrate sequence entries, part 2233. 2260. gbinv2234.seq - Invertebrate sequence entries, part 2234. 2261. gbinv2235.seq - Invertebrate sequence entries, part 2235. 2262. gbinv2236.seq - Invertebrate sequence entries, part 2236. 2263. gbinv2237.seq - Invertebrate sequence entries, part 2237. 2264. gbinv2238.seq - Invertebrate sequence entries, part 2238. 2265. gbinv2239.seq - Invertebrate sequence entries, part 2239. 2266. gbinv224.seq - Invertebrate sequence entries, part 224. 2267. gbinv2240.seq - Invertebrate sequence entries, part 2240. 2268. gbinv2241.seq - Invertebrate sequence entries, part 2241. 2269. gbinv2242.seq - Invertebrate sequence entries, part 2242. 2270. gbinv2243.seq - Invertebrate sequence entries, part 2243. 2271. gbinv2244.seq - Invertebrate sequence entries, part 2244. 2272. gbinv2245.seq - Invertebrate sequence entries, part 2245. 2273. gbinv2246.seq - Invertebrate sequence entries, part 2246. 2274. gbinv2247.seq - Invertebrate sequence entries, part 2247. 2275. gbinv2248.seq - Invertebrate sequence entries, part 2248. 2276. gbinv2249.seq - Invertebrate sequence entries, part 2249. 2277. gbinv225.seq - Invertebrate sequence entries, part 225. 2278. gbinv2250.seq - Invertebrate sequence entries, part 2250. 2279. gbinv2251.seq - Invertebrate sequence entries, part 2251. 2280. gbinv2252.seq - Invertebrate sequence entries, part 2252. 2281. gbinv2253.seq - Invertebrate sequence entries, part 2253. 2282. gbinv2254.seq - Invertebrate sequence entries, part 2254. 2283. gbinv2255.seq - Invertebrate sequence entries, part 2255. 2284. gbinv2256.seq - Invertebrate sequence entries, part 2256. 2285. gbinv2257.seq - Invertebrate sequence entries, part 2257. 2286. gbinv2258.seq - Invertebrate sequence entries, part 2258. 2287. gbinv2259.seq - Invertebrate sequence entries, part 2259. 2288. gbinv226.seq - Invertebrate sequence entries, part 226. 2289. gbinv2260.seq - Invertebrate sequence entries, part 2260. 2290. gbinv2261.seq - Invertebrate sequence entries, part 2261. 2291. gbinv2262.seq - Invertebrate sequence entries, part 2262. 2292. gbinv2263.seq - Invertebrate sequence entries, part 2263. 2293. gbinv2264.seq - Invertebrate sequence entries, part 2264. 2294. gbinv2265.seq - Invertebrate sequence entries, part 2265. 2295. gbinv2266.seq - Invertebrate sequence entries, part 2266. 2296. gbinv2267.seq - Invertebrate sequence entries, part 2267. 2297. gbinv2268.seq - Invertebrate sequence entries, part 2268. 2298. gbinv2269.seq - Invertebrate sequence entries, part 2269. 2299. gbinv227.seq - Invertebrate sequence entries, part 227. 2300. gbinv2270.seq - Invertebrate sequence entries, part 2270. 2301. gbinv2271.seq - Invertebrate sequence entries, part 2271. 2302. gbinv2272.seq - Invertebrate sequence entries, part 2272. 2303. gbinv2273.seq - Invertebrate sequence entries, part 2273. 2304. gbinv2274.seq - Invertebrate sequence entries, part 2274. 2305. gbinv2275.seq - Invertebrate sequence entries, part 2275. 2306. gbinv2276.seq - Invertebrate sequence entries, part 2276. 2307. gbinv2277.seq - Invertebrate sequence entries, part 2277. 2308. gbinv2278.seq - Invertebrate sequence entries, part 2278. 2309. gbinv2279.seq - Invertebrate sequence entries, part 2279. 2310. gbinv228.seq - Invertebrate sequence entries, part 228. 2311. gbinv2280.seq - Invertebrate sequence entries, part 2280. 2312. gbinv2281.seq - Invertebrate sequence entries, part 2281. 2313. gbinv2282.seq - Invertebrate sequence entries, part 2282. 2314. gbinv2283.seq - Invertebrate sequence entries, part 2283. 2315. gbinv2284.seq - Invertebrate sequence entries, part 2284. 2316. gbinv2285.seq - Invertebrate sequence entries, part 2285. 2317. gbinv2286.seq - Invertebrate sequence entries, part 2286. 2318. gbinv2287.seq - Invertebrate sequence entries, part 2287. 2319. gbinv2288.seq - Invertebrate sequence entries, part 2288. 2320. gbinv2289.seq - Invertebrate sequence entries, part 2289. 2321. gbinv229.seq - Invertebrate sequence entries, part 229. 2322. gbinv2290.seq - Invertebrate sequence entries, part 2290. 2323. gbinv2291.seq - Invertebrate sequence entries, part 2291. 2324. gbinv2292.seq - Invertebrate sequence entries, part 2292. 2325. gbinv2293.seq - Invertebrate sequence entries, part 2293. 2326. gbinv2294.seq - Invertebrate sequence entries, part 2294. 2327. gbinv2295.seq - Invertebrate sequence entries, part 2295. 2328. gbinv2296.seq - Invertebrate sequence entries, part 2296. 2329. gbinv2297.seq - Invertebrate sequence entries, part 2297. 2330. gbinv2298.seq - Invertebrate sequence entries, part 2298. 2331. gbinv2299.seq - Invertebrate sequence entries, part 2299. 2332. gbinv23.seq - Invertebrate sequence entries, part 23. 2333. gbinv230.seq - Invertebrate sequence entries, part 230. 2334. gbinv2300.seq - Invertebrate sequence entries, part 2300. 2335. gbinv2301.seq - Invertebrate sequence entries, part 2301. 2336. gbinv2302.seq - Invertebrate sequence entries, part 2302. 2337. gbinv2303.seq - Invertebrate sequence entries, part 2303. 2338. gbinv2304.seq - Invertebrate sequence entries, part 2304. 2339. gbinv2305.seq - Invertebrate sequence entries, part 2305. 2340. gbinv2306.seq - Invertebrate sequence entries, part 2306. 2341. gbinv231.seq - Invertebrate sequence entries, part 231. 2342. gbinv232.seq - Invertebrate sequence entries, part 232. 2343. gbinv233.seq - Invertebrate sequence entries, part 233. 2344. gbinv234.seq - Invertebrate sequence entries, part 234. 2345. gbinv235.seq - Invertebrate sequence entries, part 235. 2346. gbinv236.seq - Invertebrate sequence entries, part 236. 2347. gbinv237.seq - Invertebrate sequence entries, part 237. 2348. gbinv238.seq - Invertebrate sequence entries, part 238. 2349. gbinv239.seq - Invertebrate sequence entries, part 239. 2350. gbinv24.seq - Invertebrate sequence entries, part 24. 2351. gbinv240.seq - Invertebrate sequence entries, part 240. 2352. gbinv241.seq - Invertebrate sequence entries, part 241. 2353. gbinv242.seq - Invertebrate sequence entries, part 242. 2354. gbinv243.seq - Invertebrate sequence entries, part 243. 2355. gbinv244.seq - Invertebrate sequence entries, part 244. 2356. gbinv245.seq - Invertebrate sequence entries, part 245. 2357. gbinv246.seq - Invertebrate sequence entries, part 246. 2358. gbinv247.seq - Invertebrate sequence entries, part 247. 2359. gbinv248.seq - Invertebrate sequence entries, part 248. 2360. gbinv249.seq - Invertebrate sequence entries, part 249. 2361. gbinv25.seq - Invertebrate sequence entries, part 25. 2362. gbinv250.seq - Invertebrate sequence entries, part 250. 2363. gbinv251.seq - Invertebrate sequence entries, part 251. 2364. gbinv252.seq - Invertebrate sequence entries, part 252. 2365. gbinv253.seq - Invertebrate sequence entries, part 253. 2366. gbinv254.seq - Invertebrate sequence entries, part 254. 2367. gbinv255.seq - Invertebrate sequence entries, part 255. 2368. gbinv256.seq - Invertebrate sequence entries, part 256. 2369. gbinv257.seq - Invertebrate sequence entries, part 257. 2370. gbinv258.seq - Invertebrate sequence entries, part 258. 2371. gbinv259.seq - Invertebrate sequence entries, part 259. 2372. gbinv26.seq - Invertebrate sequence entries, part 26. 2373. gbinv260.seq - Invertebrate sequence entries, part 260. 2374. gbinv261.seq - Invertebrate sequence entries, part 261. 2375. gbinv262.seq - Invertebrate sequence entries, part 262. 2376. gbinv263.seq - Invertebrate sequence entries, part 263. 2377. gbinv264.seq - Invertebrate sequence entries, part 264. 2378. gbinv265.seq - Invertebrate sequence entries, part 265. 2379. gbinv266.seq - Invertebrate sequence entries, part 266. 2380. gbinv267.seq - Invertebrate sequence entries, part 267. 2381. gbinv268.seq - Invertebrate sequence entries, part 268. 2382. gbinv269.seq - Invertebrate sequence entries, part 269. 2383. gbinv27.seq - Invertebrate sequence entries, part 27. 2384. gbinv270.seq - Invertebrate sequence entries, part 270. 2385. gbinv271.seq - Invertebrate sequence entries, part 271. 2386. gbinv272.seq - Invertebrate sequence entries, part 272. 2387. gbinv273.seq - Invertebrate sequence entries, part 273. 2388. gbinv274.seq - Invertebrate sequence entries, part 274. 2389. gbinv275.seq - Invertebrate sequence entries, part 275. 2390. gbinv276.seq - Invertebrate sequence entries, part 276. 2391. gbinv277.seq - Invertebrate sequence entries, part 277. 2392. gbinv278.seq - Invertebrate sequence entries, part 278. 2393. gbinv279.seq - Invertebrate sequence entries, part 279. 2394. gbinv28.seq - Invertebrate sequence entries, part 28. 2395. gbinv280.seq - Invertebrate sequence entries, part 280. 2396. gbinv281.seq - Invertebrate sequence entries, part 281. 2397. gbinv282.seq - Invertebrate sequence entries, part 282. 2398. gbinv283.seq - Invertebrate sequence entries, part 283. 2399. gbinv284.seq - Invertebrate sequence entries, part 284. 2400. gbinv285.seq - Invertebrate sequence entries, part 285. 2401. gbinv286.seq - Invertebrate sequence entries, part 286. 2402. gbinv287.seq - Invertebrate sequence entries, part 287. 2403. gbinv288.seq - Invertebrate sequence entries, part 288. 2404. gbinv289.seq - Invertebrate sequence entries, part 289. 2405. gbinv29.seq - Invertebrate sequence entries, part 29. 2406. gbinv290.seq - Invertebrate sequence entries, part 290. 2407. gbinv291.seq - Invertebrate sequence entries, part 291. 2408. gbinv292.seq - Invertebrate sequence entries, part 292. 2409. gbinv293.seq - Invertebrate sequence entries, part 293. 2410. gbinv294.seq - Invertebrate sequence entries, part 294. 2411. gbinv295.seq - Invertebrate sequence entries, part 295. 2412. gbinv296.seq - Invertebrate sequence entries, part 296. 2413. gbinv297.seq - Invertebrate sequence entries, part 297. 2414. gbinv298.seq - Invertebrate sequence entries, part 298. 2415. gbinv299.seq - Invertebrate sequence entries, part 299. 2416. gbinv3.seq - Invertebrate sequence entries, part 3. 2417. gbinv30.seq - Invertebrate sequence entries, part 30. 2418. gbinv300.seq - Invertebrate sequence entries, part 300. 2419. gbinv301.seq - Invertebrate sequence entries, part 301. 2420. gbinv302.seq - Invertebrate sequence entries, part 302. 2421. gbinv303.seq - Invertebrate sequence entries, part 303. 2422. gbinv304.seq - Invertebrate sequence entries, part 304. 2423. gbinv305.seq - Invertebrate sequence entries, part 305. 2424. gbinv306.seq - Invertebrate sequence entries, part 306. 2425. gbinv307.seq - Invertebrate sequence entries, part 307. 2426. gbinv308.seq - Invertebrate sequence entries, part 308. 2427. gbinv309.seq - Invertebrate sequence entries, part 309. 2428. gbinv31.seq - Invertebrate sequence entries, part 31. 2429. gbinv310.seq - Invertebrate sequence entries, part 310. 2430. gbinv311.seq - Invertebrate sequence entries, part 311. 2431. gbinv312.seq - Invertebrate sequence entries, part 312. 2432. gbinv313.seq - Invertebrate sequence entries, part 313. 2433. gbinv314.seq - Invertebrate sequence entries, part 314. 2434. gbinv315.seq - Invertebrate sequence entries, part 315. 2435. gbinv316.seq - Invertebrate sequence entries, part 316. 2436. gbinv317.seq - Invertebrate sequence entries, part 317. 2437. gbinv318.seq - Invertebrate sequence entries, part 318. 2438. gbinv319.seq - Invertebrate sequence entries, part 319. 2439. gbinv32.seq - Invertebrate sequence entries, part 32. 2440. gbinv320.seq - Invertebrate sequence entries, part 320. 2441. gbinv321.seq - Invertebrate sequence entries, part 321. 2442. gbinv322.seq - Invertebrate sequence entries, part 322. 2443. gbinv323.seq - Invertebrate sequence entries, part 323. 2444. gbinv324.seq - Invertebrate sequence entries, part 324. 2445. gbinv325.seq - Invertebrate sequence entries, part 325. 2446. gbinv326.seq - Invertebrate sequence entries, part 326. 2447. gbinv327.seq - Invertebrate sequence entries, part 327. 2448. gbinv328.seq - Invertebrate sequence entries, part 328. 2449. gbinv329.seq - Invertebrate sequence entries, part 329. 2450. gbinv33.seq - Invertebrate sequence entries, part 33. 2451. gbinv330.seq - Invertebrate sequence entries, part 330. 2452. gbinv331.seq - Invertebrate sequence entries, part 331. 2453. gbinv332.seq - Invertebrate sequence entries, part 332. 2454. gbinv333.seq - Invertebrate sequence entries, part 333. 2455. gbinv334.seq - Invertebrate sequence entries, part 334. 2456. gbinv335.seq - Invertebrate sequence entries, part 335. 2457. gbinv336.seq - Invertebrate sequence entries, part 336. 2458. gbinv337.seq - Invertebrate sequence entries, part 337. 2459. gbinv338.seq - Invertebrate sequence entries, part 338. 2460. gbinv339.seq - Invertebrate sequence entries, part 339. 2461. gbinv34.seq - Invertebrate sequence entries, part 34. 2462. gbinv340.seq - Invertebrate sequence entries, part 340. 2463. gbinv341.seq - Invertebrate sequence entries, part 341. 2464. gbinv342.seq - Invertebrate sequence entries, part 342. 2465. gbinv343.seq - Invertebrate sequence entries, part 343. 2466. gbinv344.seq - Invertebrate sequence entries, part 344. 2467. gbinv345.seq - Invertebrate sequence entries, part 345. 2468. gbinv346.seq - Invertebrate sequence entries, part 346. 2469. gbinv347.seq - Invertebrate sequence entries, part 347. 2470. gbinv348.seq - Invertebrate sequence entries, part 348. 2471. gbinv349.seq - Invertebrate sequence entries, part 349. 2472. gbinv35.seq - Invertebrate sequence entries, part 35. 2473. gbinv350.seq - Invertebrate sequence entries, part 350. 2474. gbinv351.seq - Invertebrate sequence entries, part 351. 2475. gbinv352.seq - Invertebrate sequence entries, part 352. 2476. gbinv353.seq - Invertebrate sequence entries, part 353. 2477. gbinv354.seq - Invertebrate sequence entries, part 354. 2478. gbinv355.seq - Invertebrate sequence entries, part 355. 2479. gbinv356.seq - Invertebrate sequence entries, part 356. 2480. gbinv357.seq - Invertebrate sequence entries, part 357. 2481. gbinv358.seq - Invertebrate sequence entries, part 358. 2482. gbinv359.seq - Invertebrate sequence entries, part 359. 2483. gbinv36.seq - Invertebrate sequence entries, part 36. 2484. gbinv360.seq - Invertebrate sequence entries, part 360. 2485. gbinv361.seq - Invertebrate sequence entries, part 361. 2486. gbinv362.seq - Invertebrate sequence entries, part 362. 2487. gbinv363.seq - Invertebrate sequence entries, part 363. 2488. gbinv364.seq - Invertebrate sequence entries, part 364. 2489. gbinv365.seq - Invertebrate sequence entries, part 365. 2490. gbinv366.seq - Invertebrate sequence entries, part 366. 2491. gbinv367.seq - Invertebrate sequence entries, part 367. 2492. gbinv368.seq - Invertebrate sequence entries, part 368. 2493. gbinv369.seq - Invertebrate sequence entries, part 369. 2494. gbinv37.seq - Invertebrate sequence entries, part 37. 2495. gbinv370.seq - Invertebrate sequence entries, part 370. 2496. gbinv371.seq - Invertebrate sequence entries, part 371. 2497. gbinv372.seq - Invertebrate sequence entries, part 372. 2498. gbinv373.seq - Invertebrate sequence entries, part 373. 2499. gbinv374.seq - Invertebrate sequence entries, part 374. 2500. gbinv375.seq - Invertebrate sequence entries, part 375. 2501. gbinv376.seq - Invertebrate sequence entries, part 376. 2502. gbinv377.seq - Invertebrate sequence entries, part 377. 2503. gbinv378.seq - Invertebrate sequence entries, part 378. 2504. gbinv379.seq - Invertebrate sequence entries, part 379. 2505. gbinv38.seq - Invertebrate sequence entries, part 38. 2506. gbinv380.seq - Invertebrate sequence entries, part 380. 2507. gbinv381.seq - Invertebrate sequence entries, part 381. 2508. gbinv382.seq - Invertebrate sequence entries, part 382. 2509. gbinv383.seq - Invertebrate sequence entries, part 383. 2510. gbinv384.seq - Invertebrate sequence entries, part 384. 2511. gbinv385.seq - Invertebrate sequence entries, part 385. 2512. gbinv386.seq - Invertebrate sequence entries, part 386. 2513. gbinv387.seq - Invertebrate sequence entries, part 387. 2514. gbinv388.seq - Invertebrate sequence entries, part 388. 2515. gbinv389.seq - Invertebrate sequence entries, part 389. 2516. gbinv39.seq - Invertebrate sequence entries, part 39. 2517. gbinv390.seq - Invertebrate sequence entries, part 390. 2518. gbinv391.seq - Invertebrate sequence entries, part 391. 2519. gbinv392.seq - Invertebrate sequence entries, part 392. 2520. gbinv393.seq - Invertebrate sequence entries, part 393. 2521. gbinv394.seq - Invertebrate sequence entries, part 394. 2522. gbinv395.seq - Invertebrate sequence entries, part 395. 2523. gbinv396.seq - Invertebrate sequence entries, part 396. 2524. gbinv397.seq - Invertebrate sequence entries, part 397. 2525. gbinv398.seq - Invertebrate sequence entries, part 398. 2526. gbinv399.seq - Invertebrate sequence entries, part 399. 2527. gbinv4.seq - Invertebrate sequence entries, part 4. 2528. gbinv40.seq - Invertebrate sequence entries, part 40. 2529. gbinv400.seq - Invertebrate sequence entries, part 400. 2530. gbinv401.seq - Invertebrate sequence entries, part 401. 2531. gbinv402.seq - Invertebrate sequence entries, part 402. 2532. gbinv403.seq - Invertebrate sequence entries, part 403. 2533. gbinv404.seq - Invertebrate sequence entries, part 404. 2534. gbinv405.seq - Invertebrate sequence entries, part 405. 2535. gbinv406.seq - Invertebrate sequence entries, part 406. 2536. gbinv407.seq - Invertebrate sequence entries, part 407. 2537. gbinv408.seq - Invertebrate sequence entries, part 408. 2538. gbinv409.seq - Invertebrate sequence entries, part 409. 2539. gbinv41.seq - Invertebrate sequence entries, part 41. 2540. gbinv410.seq - Invertebrate sequence entries, part 410. 2541. gbinv411.seq - Invertebrate sequence entries, part 411. 2542. gbinv412.seq - Invertebrate sequence entries, part 412. 2543. gbinv413.seq - Invertebrate sequence entries, part 413. 2544. gbinv414.seq - Invertebrate sequence entries, part 414. 2545. gbinv415.seq - Invertebrate sequence entries, part 415. 2546. gbinv416.seq - Invertebrate sequence entries, part 416. 2547. gbinv417.seq - Invertebrate sequence entries, part 417. 2548. gbinv418.seq - Invertebrate sequence entries, part 418. 2549. gbinv419.seq - Invertebrate sequence entries, part 419. 2550. gbinv42.seq - Invertebrate sequence entries, part 42. 2551. gbinv420.seq - Invertebrate sequence entries, part 420. 2552. gbinv421.seq - Invertebrate sequence entries, part 421. 2553. gbinv422.seq - Invertebrate sequence entries, part 422. 2554. gbinv423.seq - Invertebrate sequence entries, part 423. 2555. gbinv424.seq - Invertebrate sequence entries, part 424. 2556. gbinv425.seq - Invertebrate sequence entries, part 425. 2557. gbinv426.seq - Invertebrate sequence entries, part 426. 2558. gbinv427.seq - Invertebrate sequence entries, part 427. 2559. gbinv428.seq - Invertebrate sequence entries, part 428. 2560. gbinv429.seq - Invertebrate sequence entries, part 429. 2561. gbinv43.seq - Invertebrate sequence entries, part 43. 2562. gbinv430.seq - Invertebrate sequence entries, part 430. 2563. gbinv431.seq - Invertebrate sequence entries, part 431. 2564. gbinv432.seq - Invertebrate sequence entries, part 432. 2565. gbinv433.seq - Invertebrate sequence entries, part 433. 2566. gbinv434.seq - Invertebrate sequence entries, part 434. 2567. gbinv435.seq - Invertebrate sequence entries, part 435. 2568. gbinv436.seq - Invertebrate sequence entries, part 436. 2569. gbinv437.seq - Invertebrate sequence entries, part 437. 2570. gbinv438.seq - Invertebrate sequence entries, part 438. 2571. gbinv439.seq - Invertebrate sequence entries, part 439. 2572. gbinv44.seq - Invertebrate sequence entries, part 44. 2573. gbinv440.seq - Invertebrate sequence entries, part 440. 2574. gbinv441.seq - Invertebrate sequence entries, part 441. 2575. gbinv442.seq - Invertebrate sequence entries, part 442. 2576. gbinv443.seq - Invertebrate sequence entries, part 443. 2577. gbinv444.seq - Invertebrate sequence entries, part 444. 2578. gbinv445.seq - Invertebrate sequence entries, part 445. 2579. gbinv446.seq - Invertebrate sequence entries, part 446. 2580. gbinv447.seq - Invertebrate sequence entries, part 447. 2581. gbinv448.seq - Invertebrate sequence entries, part 448. 2582. gbinv449.seq - Invertebrate sequence entries, part 449. 2583. gbinv45.seq - Invertebrate sequence entries, part 45. 2584. gbinv450.seq - Invertebrate sequence entries, part 450. 2585. gbinv451.seq - Invertebrate sequence entries, part 451. 2586. gbinv452.seq - Invertebrate sequence entries, part 452. 2587. gbinv453.seq - Invertebrate sequence entries, part 453. 2588. gbinv454.seq - Invertebrate sequence entries, part 454. 2589. gbinv455.seq - Invertebrate sequence entries, part 455. 2590. gbinv456.seq - Invertebrate sequence entries, part 456. 2591. gbinv457.seq - Invertebrate sequence entries, part 457. 2592. gbinv458.seq - Invertebrate sequence entries, part 458. 2593. gbinv459.seq - Invertebrate sequence entries, part 459. 2594. gbinv46.seq - Invertebrate sequence entries, part 46. 2595. gbinv460.seq - Invertebrate sequence entries, part 460. 2596. gbinv461.seq - Invertebrate sequence entries, part 461. 2597. gbinv462.seq - Invertebrate sequence entries, part 462. 2598. gbinv463.seq - Invertebrate sequence entries, part 463. 2599. gbinv464.seq - Invertebrate sequence entries, part 464. 2600. gbinv465.seq - Invertebrate sequence entries, part 465. 2601. gbinv466.seq - Invertebrate sequence entries, part 466. 2602. gbinv467.seq - Invertebrate sequence entries, part 467. 2603. gbinv468.seq - Invertebrate sequence entries, part 468. 2604. gbinv469.seq - Invertebrate sequence entries, part 469. 2605. gbinv47.seq - Invertebrate sequence entries, part 47. 2606. gbinv470.seq - Invertebrate sequence entries, part 470. 2607. gbinv471.seq - Invertebrate sequence entries, part 471. 2608. gbinv472.seq - Invertebrate sequence entries, part 472. 2609. gbinv473.seq - Invertebrate sequence entries, part 473. 2610. gbinv474.seq - Invertebrate sequence entries, part 474. 2611. gbinv475.seq - Invertebrate sequence entries, part 475. 2612. gbinv476.seq - Invertebrate sequence entries, part 476. 2613. gbinv477.seq - Invertebrate sequence entries, part 477. 2614. gbinv478.seq - Invertebrate sequence entries, part 478. 2615. gbinv479.seq - Invertebrate sequence entries, part 479. 2616. gbinv48.seq - Invertebrate sequence entries, part 48. 2617. gbinv480.seq - Invertebrate sequence entries, part 480. 2618. gbinv481.seq - Invertebrate sequence entries, part 481. 2619. gbinv482.seq - Invertebrate sequence entries, part 482. 2620. gbinv483.seq - Invertebrate sequence entries, part 483. 2621. gbinv484.seq - Invertebrate sequence entries, part 484. 2622. gbinv485.seq - Invertebrate sequence entries, part 485. 2623. gbinv486.seq - Invertebrate sequence entries, part 486. 2624. gbinv487.seq - Invertebrate sequence entries, part 487. 2625. gbinv488.seq - Invertebrate sequence entries, part 488. 2626. gbinv489.seq - Invertebrate sequence entries, part 489. 2627. gbinv49.seq - Invertebrate sequence entries, part 49. 2628. gbinv490.seq - Invertebrate sequence entries, part 490. 2629. gbinv491.seq - Invertebrate sequence entries, part 491. 2630. gbinv492.seq - Invertebrate sequence entries, part 492. 2631. gbinv493.seq - Invertebrate sequence entries, part 493. 2632. gbinv494.seq - Invertebrate sequence entries, part 494. 2633. gbinv495.seq - Invertebrate sequence entries, part 495. 2634. gbinv496.seq - Invertebrate sequence entries, part 496. 2635. gbinv497.seq - Invertebrate sequence entries, part 497. 2636. gbinv498.seq - Invertebrate sequence entries, part 498. 2637. gbinv499.seq - Invertebrate sequence entries, part 499. 2638. gbinv5.seq - Invertebrate sequence entries, part 5. 2639. gbinv50.seq - Invertebrate sequence entries, part 50. 2640. gbinv500.seq - Invertebrate sequence entries, part 500. 2641. gbinv501.seq - Invertebrate sequence entries, part 501. 2642. gbinv502.seq - Invertebrate sequence entries, part 502. 2643. gbinv503.seq - Invertebrate sequence entries, part 503. 2644. gbinv504.seq - Invertebrate sequence entries, part 504. 2645. gbinv505.seq - Invertebrate sequence entries, part 505. 2646. gbinv506.seq - Invertebrate sequence entries, part 506. 2647. gbinv507.seq - Invertebrate sequence entries, part 507. 2648. gbinv508.seq - Invertebrate sequence entries, part 508. 2649. gbinv509.seq - Invertebrate sequence entries, part 509. 2650. gbinv51.seq - Invertebrate sequence entries, part 51. 2651. gbinv510.seq - Invertebrate sequence entries, part 510. 2652. gbinv511.seq - Invertebrate sequence entries, part 511. 2653. gbinv512.seq - Invertebrate sequence entries, part 512. 2654. gbinv513.seq - Invertebrate sequence entries, part 513. 2655. gbinv514.seq - Invertebrate sequence entries, part 514. 2656. gbinv515.seq - Invertebrate sequence entries, part 515. 2657. gbinv516.seq - Invertebrate sequence entries, part 516. 2658. gbinv517.seq - Invertebrate sequence entries, part 517. 2659. gbinv518.seq - Invertebrate sequence entries, part 518. 2660. gbinv519.seq - Invertebrate sequence entries, part 519. 2661. gbinv52.seq - Invertebrate sequence entries, part 52. 2662. gbinv520.seq - Invertebrate sequence entries, part 520. 2663. gbinv521.seq - Invertebrate sequence entries, part 521. 2664. gbinv522.seq - Invertebrate sequence entries, part 522. 2665. gbinv523.seq - Invertebrate sequence entries, part 523. 2666. gbinv524.seq - Invertebrate sequence entries, part 524. 2667. gbinv525.seq - Invertebrate sequence entries, part 525. 2668. gbinv526.seq - Invertebrate sequence entries, part 526. 2669. gbinv527.seq - Invertebrate sequence entries, part 527. 2670. gbinv528.seq - Invertebrate sequence entries, part 528. 2671. gbinv529.seq - Invertebrate sequence entries, part 529. 2672. gbinv53.seq - Invertebrate sequence entries, part 53. 2673. gbinv530.seq - Invertebrate sequence entries, part 530. 2674. gbinv531.seq - Invertebrate sequence entries, part 531. 2675. gbinv532.seq - Invertebrate sequence entries, part 532. 2676. gbinv533.seq - Invertebrate sequence entries, part 533. 2677. gbinv534.seq - Invertebrate sequence entries, part 534. 2678. gbinv535.seq - Invertebrate sequence entries, part 535. 2679. gbinv536.seq - Invertebrate sequence entries, part 536. 2680. gbinv537.seq - Invertebrate sequence entries, part 537. 2681. gbinv538.seq - Invertebrate sequence entries, part 538. 2682. gbinv539.seq - Invertebrate sequence entries, part 539. 2683. gbinv54.seq - Invertebrate sequence entries, part 54. 2684. gbinv540.seq - Invertebrate sequence entries, part 540. 2685. gbinv541.seq - Invertebrate sequence entries, part 541. 2686. gbinv542.seq - Invertebrate sequence entries, part 542. 2687. gbinv543.seq - Invertebrate sequence entries, part 543. 2688. gbinv544.seq - Invertebrate sequence entries, part 544. 2689. gbinv545.seq - Invertebrate sequence entries, part 545. 2690. gbinv546.seq - Invertebrate sequence entries, part 546. 2691. gbinv547.seq - Invertebrate sequence entries, part 547. 2692. gbinv548.seq - Invertebrate sequence entries, part 548. 2693. gbinv549.seq - Invertebrate sequence entries, part 549. 2694. gbinv55.seq - Invertebrate sequence entries, part 55. 2695. gbinv550.seq - Invertebrate sequence entries, part 550. 2696. gbinv551.seq - Invertebrate sequence entries, part 551. 2697. gbinv552.seq - Invertebrate sequence entries, part 552. 2698. gbinv553.seq - Invertebrate sequence entries, part 553. 2699. gbinv554.seq - Invertebrate sequence entries, part 554. 2700. gbinv555.seq - Invertebrate sequence entries, part 555. 2701. gbinv556.seq - Invertebrate sequence entries, part 556. 2702. gbinv557.seq - Invertebrate sequence entries, part 557. 2703. gbinv558.seq - Invertebrate sequence entries, part 558. 2704. gbinv559.seq - Invertebrate sequence entries, part 559. 2705. gbinv56.seq - Invertebrate sequence entries, part 56. 2706. gbinv560.seq - Invertebrate sequence entries, part 560. 2707. gbinv561.seq - Invertebrate sequence entries, part 561. 2708. gbinv562.seq - Invertebrate sequence entries, part 562. 2709. gbinv563.seq - Invertebrate sequence entries, part 563. 2710. gbinv564.seq - Invertebrate sequence entries, part 564. 2711. gbinv565.seq - Invertebrate sequence entries, part 565. 2712. gbinv566.seq - Invertebrate sequence entries, part 566. 2713. gbinv567.seq - Invertebrate sequence entries, part 567. 2714. gbinv568.seq - Invertebrate sequence entries, part 568. 2715. gbinv569.seq - Invertebrate sequence entries, part 569. 2716. gbinv57.seq - Invertebrate sequence entries, part 57. 2717. gbinv570.seq - Invertebrate sequence entries, part 570. 2718. gbinv571.seq - Invertebrate sequence entries, part 571. 2719. gbinv572.seq - Invertebrate sequence entries, part 572. 2720. gbinv573.seq - Invertebrate sequence entries, part 573. 2721. gbinv574.seq - Invertebrate sequence entries, part 574. 2722. gbinv575.seq - Invertebrate sequence entries, part 575. 2723. gbinv576.seq - Invertebrate sequence entries, part 576. 2724. gbinv577.seq - Invertebrate sequence entries, part 577. 2725. gbinv578.seq - Invertebrate sequence entries, part 578. 2726. gbinv579.seq - Invertebrate sequence entries, part 579. 2727. gbinv58.seq - Invertebrate sequence entries, part 58. 2728. gbinv580.seq - Invertebrate sequence entries, part 580. 2729. gbinv581.seq - Invertebrate sequence entries, part 581. 2730. gbinv582.seq - Invertebrate sequence entries, part 582. 2731. gbinv583.seq - Invertebrate sequence entries, part 583. 2732. gbinv584.seq - Invertebrate sequence entries, part 584. 2733. gbinv585.seq - Invertebrate sequence entries, part 585. 2734. gbinv586.seq - Invertebrate sequence entries, part 586. 2735. gbinv587.seq - Invertebrate sequence entries, part 587. 2736. gbinv588.seq - Invertebrate sequence entries, part 588. 2737. gbinv589.seq - Invertebrate sequence entries, part 589. 2738. gbinv59.seq - Invertebrate sequence entries, part 59. 2739. gbinv590.seq - Invertebrate sequence entries, part 590. 2740. gbinv591.seq - Invertebrate sequence entries, part 591. 2741. gbinv592.seq - Invertebrate sequence entries, part 592. 2742. gbinv593.seq - Invertebrate sequence entries, part 593. 2743. gbinv594.seq - Invertebrate sequence entries, part 594. 2744. gbinv595.seq - Invertebrate sequence entries, part 595. 2745. gbinv596.seq - Invertebrate sequence entries, part 596. 2746. gbinv597.seq - Invertebrate sequence entries, part 597. 2747. gbinv598.seq - Invertebrate sequence entries, part 598. 2748. gbinv599.seq - Invertebrate sequence entries, part 599. 2749. gbinv6.seq - Invertebrate sequence entries, part 6. 2750. gbinv60.seq - Invertebrate sequence entries, part 60. 2751. gbinv600.seq - Invertebrate sequence entries, part 600. 2752. gbinv601.seq - Invertebrate sequence entries, part 601. 2753. gbinv602.seq - Invertebrate sequence entries, part 602. 2754. gbinv603.seq - Invertebrate sequence entries, part 603. 2755. gbinv604.seq - Invertebrate sequence entries, part 604. 2756. gbinv605.seq - Invertebrate sequence entries, part 605. 2757. gbinv606.seq - Invertebrate sequence entries, part 606. 2758. gbinv607.seq - Invertebrate sequence entries, part 607. 2759. gbinv608.seq - Invertebrate sequence entries, part 608. 2760. gbinv609.seq - Invertebrate sequence entries, part 609. 2761. gbinv61.seq - Invertebrate sequence entries, part 61. 2762. gbinv610.seq - Invertebrate sequence entries, part 610. 2763. gbinv611.seq - Invertebrate sequence entries, part 611. 2764. gbinv612.seq - Invertebrate sequence entries, part 612. 2765. gbinv613.seq - Invertebrate sequence entries, part 613. 2766. gbinv614.seq - Invertebrate sequence entries, part 614. 2767. gbinv615.seq - Invertebrate sequence entries, part 615. 2768. gbinv616.seq - Invertebrate sequence entries, part 616. 2769. gbinv617.seq - Invertebrate sequence entries, part 617. 2770. gbinv618.seq - Invertebrate sequence entries, part 618. 2771. gbinv619.seq - Invertebrate sequence entries, part 619. 2772. gbinv62.seq - Invertebrate sequence entries, part 62. 2773. gbinv620.seq - Invertebrate sequence entries, part 620. 2774. gbinv621.seq - Invertebrate sequence entries, part 621. 2775. gbinv622.seq - Invertebrate sequence entries, part 622. 2776. gbinv623.seq - Invertebrate sequence entries, part 623. 2777. gbinv624.seq - Invertebrate sequence entries, part 624. 2778. gbinv625.seq - Invertebrate sequence entries, part 625. 2779. gbinv626.seq - Invertebrate sequence entries, part 626. 2780. gbinv627.seq - Invertebrate sequence entries, part 627. 2781. gbinv628.seq - Invertebrate sequence entries, part 628. 2782. gbinv629.seq - Invertebrate sequence entries, part 629. 2783. gbinv63.seq - Invertebrate sequence entries, part 63. 2784. gbinv630.seq - Invertebrate sequence entries, part 630. 2785. gbinv631.seq - Invertebrate sequence entries, part 631. 2786. gbinv632.seq - Invertebrate sequence entries, part 632. 2787. gbinv633.seq - Invertebrate sequence entries, part 633. 2788. gbinv634.seq - Invertebrate sequence entries, part 634. 2789. gbinv635.seq - Invertebrate sequence entries, part 635. 2790. gbinv636.seq - Invertebrate sequence entries, part 636. 2791. gbinv637.seq - Invertebrate sequence entries, part 637. 2792. gbinv638.seq - Invertebrate sequence entries, part 638. 2793. gbinv639.seq - Invertebrate sequence entries, part 639. 2794. gbinv64.seq - Invertebrate sequence entries, part 64. 2795. gbinv640.seq - Invertebrate sequence entries, part 640. 2796. gbinv641.seq - Invertebrate sequence entries, part 641. 2797. gbinv642.seq - Invertebrate sequence entries, part 642. 2798. gbinv643.seq - Invertebrate sequence entries, part 643. 2799. gbinv644.seq - Invertebrate sequence entries, part 644. 2800. gbinv645.seq - Invertebrate sequence entries, part 645. 2801. gbinv646.seq - Invertebrate sequence entries, part 646. 2802. gbinv647.seq - Invertebrate sequence entries, part 647. 2803. gbinv648.seq - Invertebrate sequence entries, part 648. 2804. gbinv649.seq - Invertebrate sequence entries, part 649. 2805. gbinv65.seq - Invertebrate sequence entries, part 65. 2806. gbinv650.seq - Invertebrate sequence entries, part 650. 2807. gbinv651.seq - Invertebrate sequence entries, part 651. 2808. gbinv652.seq - Invertebrate sequence entries, part 652. 2809. gbinv653.seq - Invertebrate sequence entries, part 653. 2810. gbinv654.seq - Invertebrate sequence entries, part 654. 2811. gbinv655.seq - Invertebrate sequence entries, part 655. 2812. gbinv656.seq - Invertebrate sequence entries, part 656. 2813. gbinv657.seq - Invertebrate sequence entries, part 657. 2814. gbinv658.seq - Invertebrate sequence entries, part 658. 2815. gbinv659.seq - Invertebrate sequence entries, part 659. 2816. gbinv66.seq - Invertebrate sequence entries, part 66. 2817. gbinv660.seq - Invertebrate sequence entries, part 660. 2818. gbinv661.seq - Invertebrate sequence entries, part 661. 2819. gbinv662.seq - Invertebrate sequence entries, part 662. 2820. gbinv663.seq - Invertebrate sequence entries, part 663. 2821. gbinv664.seq - Invertebrate sequence entries, part 664. 2822. gbinv665.seq - Invertebrate sequence entries, part 665. 2823. gbinv666.seq - Invertebrate sequence entries, part 666. 2824. gbinv667.seq - Invertebrate sequence entries, part 667. 2825. gbinv668.seq - Invertebrate sequence entries, part 668. 2826. gbinv669.seq - Invertebrate sequence entries, part 669. 2827. gbinv67.seq - Invertebrate sequence entries, part 67. 2828. gbinv670.seq - Invertebrate sequence entries, part 670. 2829. gbinv671.seq - Invertebrate sequence entries, part 671. 2830. gbinv672.seq - Invertebrate sequence entries, part 672. 2831. gbinv673.seq - Invertebrate sequence entries, part 673. 2832. gbinv674.seq - Invertebrate sequence entries, part 674. 2833. gbinv675.seq - Invertebrate sequence entries, part 675. 2834. gbinv676.seq - Invertebrate sequence entries, part 676. 2835. gbinv677.seq - Invertebrate sequence entries, part 677. 2836. gbinv678.seq - Invertebrate sequence entries, part 678. 2837. gbinv679.seq - Invertebrate sequence entries, part 679. 2838. gbinv68.seq - Invertebrate sequence entries, part 68. 2839. gbinv680.seq - Invertebrate sequence entries, part 680. 2840. gbinv681.seq - Invertebrate sequence entries, part 681. 2841. gbinv682.seq - Invertebrate sequence entries, part 682. 2842. gbinv683.seq - Invertebrate sequence entries, part 683. 2843. gbinv684.seq - Invertebrate sequence entries, part 684. 2844. gbinv685.seq - Invertebrate sequence entries, part 685. 2845. gbinv686.seq - Invertebrate sequence entries, part 686. 2846. gbinv687.seq - Invertebrate sequence entries, part 687. 2847. gbinv688.seq - Invertebrate sequence entries, part 688. 2848. gbinv689.seq - Invertebrate sequence entries, part 689. 2849. gbinv69.seq - Invertebrate sequence entries, part 69. 2850. gbinv690.seq - Invertebrate sequence entries, part 690. 2851. gbinv691.seq - Invertebrate sequence entries, part 691. 2852. gbinv692.seq - Invertebrate sequence entries, part 692. 2853. gbinv693.seq - Invertebrate sequence entries, part 693. 2854. gbinv694.seq - Invertebrate sequence entries, part 694. 2855. gbinv695.seq - Invertebrate sequence entries, part 695. 2856. gbinv696.seq - Invertebrate sequence entries, part 696. 2857. gbinv697.seq - Invertebrate sequence entries, part 697. 2858. gbinv698.seq - Invertebrate sequence entries, part 698. 2859. gbinv699.seq - Invertebrate sequence entries, part 699. 2860. gbinv7.seq - Invertebrate sequence entries, part 7. 2861. gbinv70.seq - Invertebrate sequence entries, part 70. 2862. gbinv700.seq - Invertebrate sequence entries, part 700. 2863. gbinv701.seq - Invertebrate sequence entries, part 701. 2864. gbinv702.seq - Invertebrate sequence entries, part 702. 2865. gbinv703.seq - Invertebrate sequence entries, part 703. 2866. gbinv704.seq - Invertebrate sequence entries, part 704. 2867. gbinv705.seq - Invertebrate sequence entries, part 705. 2868. gbinv706.seq - Invertebrate sequence entries, part 706. 2869. gbinv707.seq - Invertebrate sequence entries, part 707. 2870. gbinv708.seq - Invertebrate sequence entries, part 708. 2871. gbinv709.seq - Invertebrate sequence entries, part 709. 2872. gbinv71.seq - Invertebrate sequence entries, part 71. 2873. gbinv710.seq - Invertebrate sequence entries, part 710. 2874. gbinv711.seq - Invertebrate sequence entries, part 711. 2875. gbinv712.seq - Invertebrate sequence entries, part 712. 2876. gbinv713.seq - Invertebrate sequence entries, part 713. 2877. gbinv714.seq - Invertebrate sequence entries, part 714. 2878. gbinv715.seq - Invertebrate sequence entries, part 715. 2879. gbinv716.seq - Invertebrate sequence entries, part 716. 2880. gbinv717.seq - Invertebrate sequence entries, part 717. 2881. gbinv718.seq - Invertebrate sequence entries, part 718. 2882. gbinv719.seq - Invertebrate sequence entries, part 719. 2883. gbinv72.seq - Invertebrate sequence entries, part 72. 2884. gbinv720.seq - Invertebrate sequence entries, part 720. 2885. gbinv721.seq - Invertebrate sequence entries, part 721. 2886. gbinv722.seq - Invertebrate sequence entries, part 722. 2887. gbinv723.seq - Invertebrate sequence entries, part 723. 2888. gbinv724.seq - Invertebrate sequence entries, part 724. 2889. gbinv725.seq - Invertebrate sequence entries, part 725. 2890. gbinv726.seq - Invertebrate sequence entries, part 726. 2891. gbinv727.seq - Invertebrate sequence entries, part 727. 2892. gbinv728.seq - Invertebrate sequence entries, part 728. 2893. gbinv729.seq - Invertebrate sequence entries, part 729. 2894. gbinv73.seq - Invertebrate sequence entries, part 73. 2895. gbinv730.seq - Invertebrate sequence entries, part 730. 2896. gbinv731.seq - Invertebrate sequence entries, part 731. 2897. gbinv732.seq - Invertebrate sequence entries, part 732. 2898. gbinv733.seq - Invertebrate sequence entries, part 733. 2899. gbinv734.seq - Invertebrate sequence entries, part 734. 2900. gbinv735.seq - Invertebrate sequence entries, part 735. 2901. gbinv736.seq - Invertebrate sequence entries, part 736. 2902. gbinv737.seq - Invertebrate sequence entries, part 737. 2903. gbinv738.seq - Invertebrate sequence entries, part 738. 2904. gbinv739.seq - Invertebrate sequence entries, part 739. 2905. gbinv74.seq - Invertebrate sequence entries, part 74. 2906. gbinv740.seq - Invertebrate sequence entries, part 740. 2907. gbinv741.seq - Invertebrate sequence entries, part 741. 2908. gbinv742.seq - Invertebrate sequence entries, part 742. 2909. gbinv743.seq - Invertebrate sequence entries, part 743. 2910. gbinv744.seq - Invertebrate sequence entries, part 744. 2911. gbinv745.seq - Invertebrate sequence entries, part 745. 2912. gbinv746.seq - Invertebrate sequence entries, part 746. 2913. gbinv747.seq - Invertebrate sequence entries, part 747. 2914. gbinv748.seq - Invertebrate sequence entries, part 748. 2915. gbinv749.seq - Invertebrate sequence entries, part 749. 2916. gbinv75.seq - Invertebrate sequence entries, part 75. 2917. gbinv750.seq - Invertebrate sequence entries, part 750. 2918. gbinv751.seq - Invertebrate sequence entries, part 751. 2919. gbinv752.seq - Invertebrate sequence entries, part 752. 2920. gbinv753.seq - Invertebrate sequence entries, part 753. 2921. gbinv754.seq - Invertebrate sequence entries, part 754. 2922. gbinv755.seq - Invertebrate sequence entries, part 755. 2923. gbinv756.seq - Invertebrate sequence entries, part 756. 2924. gbinv757.seq - Invertebrate sequence entries, part 757. 2925. gbinv758.seq - Invertebrate sequence entries, part 758. 2926. gbinv759.seq - Invertebrate sequence entries, part 759. 2927. gbinv76.seq - Invertebrate sequence entries, part 76. 2928. gbinv760.seq - Invertebrate sequence entries, part 760. 2929. gbinv761.seq - Invertebrate sequence entries, part 761. 2930. gbinv762.seq - Invertebrate sequence entries, part 762. 2931. gbinv763.seq - Invertebrate sequence entries, part 763. 2932. gbinv764.seq - Invertebrate sequence entries, part 764. 2933. gbinv765.seq - Invertebrate sequence entries, part 765. 2934. gbinv766.seq - Invertebrate sequence entries, part 766. 2935. gbinv767.seq - Invertebrate sequence entries, part 767. 2936. gbinv768.seq - Invertebrate sequence entries, part 768. 2937. gbinv769.seq - Invertebrate sequence entries, part 769. 2938. gbinv77.seq - Invertebrate sequence entries, part 77. 2939. gbinv770.seq - Invertebrate sequence entries, part 770. 2940. gbinv771.seq - Invertebrate sequence entries, part 771. 2941. gbinv772.seq - Invertebrate sequence entries, part 772. 2942. gbinv773.seq - Invertebrate sequence entries, part 773. 2943. gbinv774.seq - Invertebrate sequence entries, part 774. 2944. gbinv775.seq - Invertebrate sequence entries, part 775. 2945. gbinv776.seq - Invertebrate sequence entries, part 776. 2946. gbinv777.seq - Invertebrate sequence entries, part 777. 2947. gbinv778.seq - Invertebrate sequence entries, part 778. 2948. gbinv779.seq - Invertebrate sequence entries, part 779. 2949. gbinv78.seq - Invertebrate sequence entries, part 78. 2950. gbinv780.seq - Invertebrate sequence entries, part 780. 2951. gbinv781.seq - Invertebrate sequence entries, part 781. 2952. gbinv782.seq - Invertebrate sequence entries, part 782. 2953. gbinv783.seq - Invertebrate sequence entries, part 783. 2954. gbinv784.seq - Invertebrate sequence entries, part 784. 2955. gbinv785.seq - Invertebrate sequence entries, part 785. 2956. gbinv786.seq - Invertebrate sequence entries, part 786. 2957. gbinv787.seq - Invertebrate sequence entries, part 787. 2958. gbinv788.seq - Invertebrate sequence entries, part 788. 2959. gbinv789.seq - Invertebrate sequence entries, part 789. 2960. gbinv79.seq - Invertebrate sequence entries, part 79. 2961. gbinv790.seq - Invertebrate sequence entries, part 790. 2962. gbinv791.seq - Invertebrate sequence entries, part 791. 2963. gbinv792.seq - Invertebrate sequence entries, part 792. 2964. gbinv793.seq - Invertebrate sequence entries, part 793. 2965. gbinv794.seq - Invertebrate sequence entries, part 794. 2966. gbinv795.seq - Invertebrate sequence entries, part 795. 2967. gbinv796.seq - Invertebrate sequence entries, part 796. 2968. gbinv797.seq - Invertebrate sequence entries, part 797. 2969. gbinv798.seq - Invertebrate sequence entries, part 798. 2970. gbinv799.seq - Invertebrate sequence entries, part 799. 2971. gbinv8.seq - Invertebrate sequence entries, part 8. 2972. gbinv80.seq - Invertebrate sequence entries, part 80. 2973. gbinv800.seq - Invertebrate sequence entries, part 800. 2974. gbinv801.seq - Invertebrate sequence entries, part 801. 2975. gbinv802.seq - Invertebrate sequence entries, part 802. 2976. gbinv803.seq - Invertebrate sequence entries, part 803. 2977. gbinv804.seq - Invertebrate sequence entries, part 804. 2978. gbinv805.seq - Invertebrate sequence entries, part 805. 2979. gbinv806.seq - Invertebrate sequence entries, part 806. 2980. gbinv807.seq - Invertebrate sequence entries, part 807. 2981. gbinv808.seq - Invertebrate sequence entries, part 808. 2982. gbinv809.seq - Invertebrate sequence entries, part 809. 2983. gbinv81.seq - Invertebrate sequence entries, part 81. 2984. gbinv810.seq - Invertebrate sequence entries, part 810. 2985. gbinv811.seq - Invertebrate sequence entries, part 811. 2986. gbinv812.seq - Invertebrate sequence entries, part 812. 2987. gbinv813.seq - Invertebrate sequence entries, part 813. 2988. gbinv814.seq - Invertebrate sequence entries, part 814. 2989. gbinv815.seq - Invertebrate sequence entries, part 815. 2990. gbinv816.seq - Invertebrate sequence entries, part 816. 2991. gbinv817.seq - Invertebrate sequence entries, part 817. 2992. gbinv818.seq - Invertebrate sequence entries, part 818. 2993. gbinv819.seq - Invertebrate sequence entries, part 819. 2994. gbinv82.seq - Invertebrate sequence entries, part 82. 2995. gbinv820.seq - Invertebrate sequence entries, part 820. 2996. gbinv821.seq - Invertebrate sequence entries, part 821. 2997. gbinv822.seq - Invertebrate sequence entries, part 822. 2998. gbinv823.seq - Invertebrate sequence entries, part 823. 2999. gbinv824.seq - Invertebrate sequence entries, part 824. 3000. gbinv825.seq - Invertebrate sequence entries, part 825. 3001. gbinv826.seq - Invertebrate sequence entries, part 826. 3002. gbinv827.seq - Invertebrate sequence entries, part 827. 3003. gbinv828.seq - Invertebrate sequence entries, part 828. 3004. gbinv829.seq - Invertebrate sequence entries, part 829. 3005. gbinv83.seq - Invertebrate sequence entries, part 83. 3006. gbinv830.seq - Invertebrate sequence entries, part 830. 3007. gbinv831.seq - Invertebrate sequence entries, part 831. 3008. gbinv832.seq - Invertebrate sequence entries, part 832. 3009. gbinv833.seq - Invertebrate sequence entries, part 833. 3010. gbinv834.seq - Invertebrate sequence entries, part 834. 3011. gbinv835.seq - Invertebrate sequence entries, part 835. 3012. gbinv836.seq - Invertebrate sequence entries, part 836. 3013. gbinv837.seq - Invertebrate sequence entries, part 837. 3014. gbinv838.seq - Invertebrate sequence entries, part 838. 3015. gbinv839.seq - Invertebrate sequence entries, part 839. 3016. gbinv84.seq - Invertebrate sequence entries, part 84. 3017. gbinv840.seq - Invertebrate sequence entries, part 840. 3018. gbinv841.seq - Invertebrate sequence entries, part 841. 3019. gbinv842.seq - Invertebrate sequence entries, part 842. 3020. gbinv843.seq - Invertebrate sequence entries, part 843. 3021. gbinv844.seq - Invertebrate sequence entries, part 844. 3022. gbinv845.seq - Invertebrate sequence entries, part 845. 3023. gbinv846.seq - Invertebrate sequence entries, part 846. 3024. gbinv847.seq - Invertebrate sequence entries, part 847. 3025. gbinv848.seq - Invertebrate sequence entries, part 848. 3026. gbinv849.seq - Invertebrate sequence entries, part 849. 3027. gbinv85.seq - Invertebrate sequence entries, part 85. 3028. gbinv850.seq - Invertebrate sequence entries, part 850. 3029. gbinv851.seq - Invertebrate sequence entries, part 851. 3030. gbinv852.seq - Invertebrate sequence entries, part 852. 3031. gbinv853.seq - Invertebrate sequence entries, part 853. 3032. gbinv854.seq - Invertebrate sequence entries, part 854. 3033. gbinv855.seq - Invertebrate sequence entries, part 855. 3034. gbinv856.seq - Invertebrate sequence entries, part 856. 3035. gbinv857.seq - Invertebrate sequence entries, part 857. 3036. gbinv858.seq - Invertebrate sequence entries, part 858. 3037. gbinv859.seq - Invertebrate sequence entries, part 859. 3038. gbinv86.seq - Invertebrate sequence entries, part 86. 3039. gbinv860.seq - Invertebrate sequence entries, part 860. 3040. gbinv861.seq - Invertebrate sequence entries, part 861. 3041. gbinv862.seq - Invertebrate sequence entries, part 862. 3042. gbinv863.seq - Invertebrate sequence entries, part 863. 3043. gbinv864.seq - Invertebrate sequence entries, part 864. 3044. gbinv865.seq - Invertebrate sequence entries, part 865. 3045. gbinv866.seq - Invertebrate sequence entries, part 866. 3046. gbinv867.seq - Invertebrate sequence entries, part 867. 3047. gbinv868.seq - Invertebrate sequence entries, part 868. 3048. gbinv869.seq - Invertebrate sequence entries, part 869. 3049. gbinv87.seq - Invertebrate sequence entries, part 87. 3050. gbinv870.seq - Invertebrate sequence entries, part 870. 3051. gbinv871.seq - Invertebrate sequence entries, part 871. 3052. gbinv872.seq - Invertebrate sequence entries, part 872. 3053. gbinv873.seq - Invertebrate sequence entries, part 873. 3054. gbinv874.seq - Invertebrate sequence entries, part 874. 3055. gbinv875.seq - Invertebrate sequence entries, part 875. 3056. gbinv876.seq - Invertebrate sequence entries, part 876. 3057. gbinv877.seq - Invertebrate sequence entries, part 877. 3058. gbinv878.seq - Invertebrate sequence entries, part 878. 3059. gbinv879.seq - Invertebrate sequence entries, part 879. 3060. gbinv88.seq - Invertebrate sequence entries, part 88. 3061. gbinv880.seq - Invertebrate sequence entries, part 880. 3062. gbinv881.seq - Invertebrate sequence entries, part 881. 3063. gbinv882.seq - Invertebrate sequence entries, part 882. 3064. gbinv883.seq - Invertebrate sequence entries, part 883. 3065. gbinv884.seq - Invertebrate sequence entries, part 884. 3066. gbinv885.seq - Invertebrate sequence entries, part 885. 3067. gbinv886.seq - Invertebrate sequence entries, part 886. 3068. gbinv887.seq - Invertebrate sequence entries, part 887. 3069. gbinv888.seq - Invertebrate sequence entries, part 888. 3070. gbinv889.seq - Invertebrate sequence entries, part 889. 3071. gbinv89.seq - Invertebrate sequence entries, part 89. 3072. gbinv890.seq - Invertebrate sequence entries, part 890. 3073. gbinv891.seq - Invertebrate sequence entries, part 891. 3074. gbinv892.seq - Invertebrate sequence entries, part 892. 3075. gbinv893.seq - Invertebrate sequence entries, part 893. 3076. gbinv894.seq - Invertebrate sequence entries, part 894. 3077. gbinv895.seq - Invertebrate sequence entries, part 895. 3078. gbinv896.seq - Invertebrate sequence entries, part 896. 3079. gbinv897.seq - Invertebrate sequence entries, part 897. 3080. gbinv898.seq - Invertebrate sequence entries, part 898. 3081. gbinv899.seq - Invertebrate sequence entries, part 899. 3082. gbinv9.seq - Invertebrate sequence entries, part 9. 3083. gbinv90.seq - Invertebrate sequence entries, part 90. 3084. gbinv900.seq - Invertebrate sequence entries, part 900. 3085. gbinv901.seq - Invertebrate sequence entries, part 901. 3086. gbinv902.seq - Invertebrate sequence entries, part 902. 3087. gbinv903.seq - Invertebrate sequence entries, part 903. 3088. gbinv904.seq - Invertebrate sequence entries, part 904. 3089. gbinv905.seq - Invertebrate sequence entries, part 905. 3090. gbinv906.seq - Invertebrate sequence entries, part 906. 3091. gbinv907.seq - Invertebrate sequence entries, part 907. 3092. gbinv908.seq - Invertebrate sequence entries, part 908. 3093. gbinv909.seq - Invertebrate sequence entries, part 909. 3094. gbinv91.seq - Invertebrate sequence entries, part 91. 3095. gbinv910.seq - Invertebrate sequence entries, part 910. 3096. gbinv911.seq - Invertebrate sequence entries, part 911. 3097. gbinv912.seq - Invertebrate sequence entries, part 912. 3098. gbinv913.seq - Invertebrate sequence entries, part 913. 3099. gbinv914.seq - Invertebrate sequence entries, part 914. 3100. gbinv915.seq - Invertebrate sequence entries, part 915. 3101. gbinv916.seq - Invertebrate sequence entries, part 916. 3102. gbinv917.seq - Invertebrate sequence entries, part 917. 3103. gbinv918.seq - Invertebrate sequence entries, part 918. 3104. gbinv919.seq - Invertebrate sequence entries, part 919. 3105. gbinv92.seq - Invertebrate sequence entries, part 92. 3106. gbinv920.seq - Invertebrate sequence entries, part 920. 3107. gbinv921.seq - Invertebrate sequence entries, part 921. 3108. gbinv922.seq - Invertebrate sequence entries, part 922. 3109. gbinv923.seq - Invertebrate sequence entries, part 923. 3110. gbinv924.seq - Invertebrate sequence entries, part 924. 3111. gbinv925.seq - Invertebrate sequence entries, part 925. 3112. gbinv926.seq - Invertebrate sequence entries, part 926. 3113. gbinv927.seq - Invertebrate sequence entries, part 927. 3114. gbinv928.seq - Invertebrate sequence entries, part 928. 3115. gbinv929.seq - Invertebrate sequence entries, part 929. 3116. gbinv93.seq - Invertebrate sequence entries, part 93. 3117. gbinv930.seq - Invertebrate sequence entries, part 930. 3118. gbinv931.seq - Invertebrate sequence entries, part 931. 3119. gbinv932.seq - Invertebrate sequence entries, part 932. 3120. gbinv933.seq - Invertebrate sequence entries, part 933. 3121. gbinv934.seq - Invertebrate sequence entries, part 934. 3122. gbinv935.seq - Invertebrate sequence entries, part 935. 3123. gbinv936.seq - Invertebrate sequence entries, part 936. 3124. gbinv937.seq - Invertebrate sequence entries, part 937. 3125. gbinv938.seq - Invertebrate sequence entries, part 938. 3126. gbinv939.seq - Invertebrate sequence entries, part 939. 3127. gbinv94.seq - Invertebrate sequence entries, part 94. 3128. gbinv940.seq - Invertebrate sequence entries, part 940. 3129. gbinv941.seq - Invertebrate sequence entries, part 941. 3130. gbinv942.seq - Invertebrate sequence entries, part 942. 3131. gbinv943.seq - Invertebrate sequence entries, part 943. 3132. gbinv944.seq - Invertebrate sequence entries, part 944. 3133. gbinv945.seq - Invertebrate sequence entries, part 945. 3134. gbinv946.seq - Invertebrate sequence entries, part 946. 3135. gbinv947.seq - Invertebrate sequence entries, part 947. 3136. gbinv948.seq - Invertebrate sequence entries, part 948. 3137. gbinv949.seq - Invertebrate sequence entries, part 949. 3138. gbinv95.seq - Invertebrate sequence entries, part 95. 3139. gbinv950.seq - Invertebrate sequence entries, part 950. 3140. gbinv951.seq - Invertebrate sequence entries, part 951. 3141. gbinv952.seq - Invertebrate sequence entries, part 952. 3142. gbinv953.seq - Invertebrate sequence entries, part 953. 3143. gbinv954.seq - Invertebrate sequence entries, part 954. 3144. gbinv955.seq - Invertebrate sequence entries, part 955. 3145. gbinv956.seq - Invertebrate sequence entries, part 956. 3146. gbinv957.seq - Invertebrate sequence entries, part 957. 3147. gbinv958.seq - Invertebrate sequence entries, part 958. 3148. gbinv959.seq - Invertebrate sequence entries, part 959. 3149. gbinv96.seq - Invertebrate sequence entries, part 96. 3150. gbinv960.seq - Invertebrate sequence entries, part 960. 3151. gbinv961.seq - Invertebrate sequence entries, part 961. 3152. gbinv962.seq - Invertebrate sequence entries, part 962. 3153. gbinv963.seq - Invertebrate sequence entries, part 963. 3154. gbinv964.seq - Invertebrate sequence entries, part 964. 3155. gbinv965.seq - Invertebrate sequence entries, part 965. 3156. gbinv966.seq - Invertebrate sequence entries, part 966. 3157. gbinv967.seq - Invertebrate sequence entries, part 967. 3158. gbinv968.seq - Invertebrate sequence entries, part 968. 3159. gbinv969.seq - Invertebrate sequence entries, part 969. 3160. gbinv97.seq - Invertebrate sequence entries, part 97. 3161. gbinv970.seq - Invertebrate sequence entries, part 970. 3162. gbinv971.seq - Invertebrate sequence entries, part 971. 3163. gbinv972.seq - Invertebrate sequence entries, part 972. 3164. gbinv973.seq - Invertebrate sequence entries, part 973. 3165. gbinv974.seq - Invertebrate sequence entries, part 974. 3166. gbinv975.seq - Invertebrate sequence entries, part 975. 3167. gbinv976.seq - Invertebrate sequence entries, part 976. 3168. gbinv977.seq - Invertebrate sequence entries, part 977. 3169. gbinv978.seq - Invertebrate sequence entries, part 978. 3170. gbinv979.seq - Invertebrate sequence entries, part 979. 3171. gbinv98.seq - Invertebrate sequence entries, part 98. 3172. gbinv980.seq - Invertebrate sequence entries, part 980. 3173. gbinv981.seq - Invertebrate sequence entries, part 981. 3174. gbinv982.seq - Invertebrate sequence entries, part 982. 3175. gbinv983.seq - Invertebrate sequence entries, part 983. 3176. gbinv984.seq - Invertebrate sequence entries, part 984. 3177. gbinv985.seq - Invertebrate sequence entries, part 985. 3178. gbinv986.seq - Invertebrate sequence entries, part 986. 3179. gbinv987.seq - Invertebrate sequence entries, part 987. 3180. gbinv988.seq - Invertebrate sequence entries, part 988. 3181. gbinv989.seq - Invertebrate sequence entries, part 989. 3182. gbinv99.seq - Invertebrate sequence entries, part 99. 3183. gbinv990.seq - Invertebrate sequence entries, part 990. 3184. gbinv991.seq - Invertebrate sequence entries, part 991. 3185. gbinv992.seq - Invertebrate sequence entries, part 992. 3186. gbinv993.seq - Invertebrate sequence entries, part 993. 3187. gbinv994.seq - Invertebrate sequence entries, part 994. 3188. gbinv995.seq - Invertebrate sequence entries, part 995. 3189. gbinv996.seq - Invertebrate sequence entries, part 996. 3190. gbinv997.seq - Invertebrate sequence entries, part 997. 3191. gbinv998.seq - Invertebrate sequence entries, part 998. 3192. gbinv999.seq - Invertebrate sequence entries, part 999. 3193. gbmam1.seq - Other mammalian sequence entries, part 1. 3194. gbmam10.seq - Other mammalian sequence entries, part 10. 3195. gbmam100.seq - Other mammalian sequence entries, part 100. 3196. gbmam101.seq - Other mammalian sequence entries, part 101. 3197. gbmam102.seq - Other mammalian sequence entries, part 102. 3198. gbmam103.seq - Other mammalian sequence entries, part 103. 3199. gbmam104.seq - Other mammalian sequence entries, part 104. 3200. gbmam105.seq - Other mammalian sequence entries, part 105. 3201. gbmam106.seq - Other mammalian sequence entries, part 106. 3202. gbmam107.seq - Other mammalian sequence entries, part 107. 3203. gbmam108.seq - Other mammalian sequence entries, part 108. 3204. gbmam109.seq - Other mammalian sequence entries, part 109. 3205. gbmam11.seq - Other mammalian sequence entries, part 11. 3206. gbmam110.seq - Other mammalian sequence entries, part 110. 3207. gbmam111.seq - Other mammalian sequence entries, part 111. 3208. gbmam112.seq - Other mammalian sequence entries, part 112. 3209. gbmam113.seq - Other mammalian sequence entries, part 113. 3210. gbmam114.seq - Other mammalian sequence entries, part 114. 3211. gbmam115.seq - Other mammalian sequence entries, part 115. 3212. gbmam116.seq - Other mammalian sequence entries, part 116. 3213. gbmam117.seq - Other mammalian sequence entries, part 117. 3214. gbmam118.seq - Other mammalian sequence entries, part 118. 3215. gbmam119.seq - Other mammalian sequence entries, part 119. 3216. gbmam12.seq - Other mammalian sequence entries, part 12. 3217. gbmam120.seq - Other mammalian sequence entries, part 120. 3218. gbmam121.seq - Other mammalian sequence entries, part 121. 3219. gbmam122.seq - Other mammalian sequence entries, part 122. 3220. gbmam123.seq - Other mammalian sequence entries, part 123. 3221. gbmam124.seq - Other mammalian sequence entries, part 124. 3222. gbmam125.seq - Other mammalian sequence entries, part 125. 3223. gbmam126.seq - Other mammalian sequence entries, part 126. 3224. gbmam127.seq - Other mammalian sequence entries, part 127. 3225. gbmam128.seq - Other mammalian sequence entries, part 128. 3226. gbmam129.seq - Other mammalian sequence entries, part 129. 3227. gbmam13.seq - Other mammalian sequence entries, part 13. 3228. gbmam130.seq - Other mammalian sequence entries, part 130. 3229. gbmam131.seq - Other mammalian sequence entries, part 131. 3230. gbmam132.seq - Other mammalian sequence entries, part 132. 3231. gbmam133.seq - Other mammalian sequence entries, part 133. 3232. gbmam134.seq - Other mammalian sequence entries, part 134. 3233. gbmam135.seq - Other mammalian sequence entries, part 135. 3234. gbmam136.seq - Other mammalian sequence entries, part 136. 3235. gbmam137.seq - Other mammalian sequence entries, part 137. 3236. gbmam138.seq - Other mammalian sequence entries, part 138. 3237. gbmam139.seq - Other mammalian sequence entries, part 139. 3238. gbmam14.seq - Other mammalian sequence entries, part 14. 3239. gbmam140.seq - Other mammalian sequence entries, part 140. 3240. gbmam141.seq - Other mammalian sequence entries, part 141. 3241. gbmam142.seq - Other mammalian sequence entries, part 142. 3242. gbmam143.seq - Other mammalian sequence entries, part 143. 3243. gbmam144.seq - Other mammalian sequence entries, part 144. 3244. gbmam145.seq - Other mammalian sequence entries, part 145. 3245. gbmam146.seq - Other mammalian sequence entries, part 146. 3246. gbmam147.seq - Other mammalian sequence entries, part 147. 3247. gbmam148.seq - Other mammalian sequence entries, part 148. 3248. gbmam149.seq - Other mammalian sequence entries, part 149. 3249. gbmam15.seq - Other mammalian sequence entries, part 15. 3250. gbmam150.seq - Other mammalian sequence entries, part 150. 3251. gbmam151.seq - Other mammalian sequence entries, part 151. 3252. gbmam152.seq - Other mammalian sequence entries, part 152. 3253. gbmam153.seq - Other mammalian sequence entries, part 153. 3254. gbmam154.seq - Other mammalian sequence entries, part 154. 3255. gbmam155.seq - Other mammalian sequence entries, part 155. 3256. gbmam156.seq - Other mammalian sequence entries, part 156. 3257. gbmam157.seq - Other mammalian sequence entries, part 157. 3258. gbmam158.seq - Other mammalian sequence entries, part 158. 3259. gbmam159.seq - Other mammalian sequence entries, part 159. 3260. gbmam16.seq - Other mammalian sequence entries, part 16. 3261. gbmam160.seq - Other mammalian sequence entries, part 160. 3262. gbmam161.seq - Other mammalian sequence entries, part 161. 3263. gbmam162.seq - Other mammalian sequence entries, part 162. 3264. gbmam163.seq - Other mammalian sequence entries, part 163. 3265. gbmam164.seq - Other mammalian sequence entries, part 164. 3266. gbmam165.seq - Other mammalian sequence entries, part 165. 3267. gbmam166.seq - Other mammalian sequence entries, part 166. 3268. gbmam167.seq - Other mammalian sequence entries, part 167. 3269. gbmam168.seq - Other mammalian sequence entries, part 168. 3270. gbmam169.seq - Other mammalian sequence entries, part 169. 3271. gbmam17.seq - Other mammalian sequence entries, part 17. 3272. gbmam170.seq - Other mammalian sequence entries, part 170. 3273. gbmam171.seq - Other mammalian sequence entries, part 171. 3274. gbmam172.seq - Other mammalian sequence entries, part 172. 3275. gbmam173.seq - Other mammalian sequence entries, part 173. 3276. gbmam174.seq - Other mammalian sequence entries, part 174. 3277. gbmam175.seq - Other mammalian sequence entries, part 175. 3278. gbmam176.seq - Other mammalian sequence entries, part 176. 3279. gbmam177.seq - Other mammalian sequence entries, part 177. 3280. gbmam178.seq - Other mammalian sequence entries, part 178. 3281. gbmam179.seq - Other mammalian sequence entries, part 179. 3282. gbmam18.seq - Other mammalian sequence entries, part 18. 3283. gbmam180.seq - Other mammalian sequence entries, part 180. 3284. gbmam181.seq - Other mammalian sequence entries, part 181. 3285. gbmam182.seq - Other mammalian sequence entries, part 182. 3286. gbmam183.seq - Other mammalian sequence entries, part 183. 3287. gbmam184.seq - Other mammalian sequence entries, part 184. 3288. gbmam185.seq - Other mammalian sequence entries, part 185. 3289. gbmam186.seq - Other mammalian sequence entries, part 186. 3290. gbmam187.seq - Other mammalian sequence entries, part 187. 3291. gbmam188.seq - Other mammalian sequence entries, part 188. 3292. gbmam189.seq - Other mammalian sequence entries, part 189. 3293. gbmam19.seq - Other mammalian sequence entries, part 19. 3294. gbmam190.seq - Other mammalian sequence entries, part 190. 3295. gbmam191.seq - Other mammalian sequence entries, part 191. 3296. gbmam192.seq - Other mammalian sequence entries, part 192. 3297. gbmam193.seq - Other mammalian sequence entries, part 193. 3298. gbmam194.seq - Other mammalian sequence entries, part 194. 3299. gbmam195.seq - Other mammalian sequence entries, part 195. 3300. gbmam196.seq - Other mammalian sequence entries, part 196. 3301. gbmam197.seq - Other mammalian sequence entries, part 197. 3302. gbmam198.seq - Other mammalian sequence entries, part 198. 3303. gbmam199.seq - Other mammalian sequence entries, part 199. 3304. gbmam2.seq - Other mammalian sequence entries, part 2. 3305. gbmam20.seq - Other mammalian sequence entries, part 20. 3306. gbmam200.seq - Other mammalian sequence entries, part 200. 3307. gbmam201.seq - Other mammalian sequence entries, part 201. 3308. gbmam202.seq - Other mammalian sequence entries, part 202. 3309. gbmam203.seq - Other mammalian sequence entries, part 203. 3310. gbmam204.seq - Other mammalian sequence entries, part 204. 3311. gbmam205.seq - Other mammalian sequence entries, part 205. 3312. gbmam206.seq - Other mammalian sequence entries, part 206. 3313. gbmam207.seq - Other mammalian sequence entries, part 207. 3314. gbmam208.seq - Other mammalian sequence entries, part 208. 3315. gbmam209.seq - Other mammalian sequence entries, part 209. 3316. gbmam21.seq - Other mammalian sequence entries, part 21. 3317. gbmam210.seq - Other mammalian sequence entries, part 210. 3318. gbmam211.seq - Other mammalian sequence entries, part 211. 3319. gbmam212.seq - Other mammalian sequence entries, part 212. 3320. gbmam213.seq - Other mammalian sequence entries, part 213. 3321. gbmam214.seq - Other mammalian sequence entries, part 214. 3322. gbmam215.seq - Other mammalian sequence entries, part 215. 3323. gbmam216.seq - Other mammalian sequence entries, part 216. 3324. gbmam217.seq - Other mammalian sequence entries, part 217. 3325. gbmam218.seq - Other mammalian sequence entries, part 218. 3326. gbmam219.seq - Other mammalian sequence entries, part 219. 3327. gbmam22.seq - Other mammalian sequence entries, part 22. 3328. gbmam220.seq - Other mammalian sequence entries, part 220. 3329. gbmam221.seq - Other mammalian sequence entries, part 221. 3330. gbmam222.seq - Other mammalian sequence entries, part 222. 3331. gbmam223.seq - Other mammalian sequence entries, part 223. 3332. gbmam224.seq - Other mammalian sequence entries, part 224. 3333. gbmam225.seq - Other mammalian sequence entries, part 225. 3334. gbmam226.seq - Other mammalian sequence entries, part 226. 3335. gbmam227.seq - Other mammalian sequence entries, part 227. 3336. gbmam228.seq - Other mammalian sequence entries, part 228. 3337. gbmam229.seq - Other mammalian sequence entries, part 229. 3338. gbmam23.seq - Other mammalian sequence entries, part 23. 3339. gbmam230.seq - Other mammalian sequence entries, part 230. 3340. gbmam231.seq - Other mammalian sequence entries, part 231. 3341. gbmam232.seq - Other mammalian sequence entries, part 232. 3342. gbmam233.seq - Other mammalian sequence entries, part 233. 3343. gbmam234.seq - Other mammalian sequence entries, part 234. 3344. gbmam235.seq - Other mammalian sequence entries, part 235. 3345. gbmam24.seq - Other mammalian sequence entries, part 24. 3346. gbmam25.seq - Other mammalian sequence entries, part 25. 3347. gbmam26.seq - Other mammalian sequence entries, part 26. 3348. gbmam27.seq - Other mammalian sequence entries, part 27. 3349. gbmam28.seq - Other mammalian sequence entries, part 28. 3350. gbmam29.seq - Other mammalian sequence entries, part 29. 3351. gbmam3.seq - Other mammalian sequence entries, part 3. 3352. gbmam30.seq - Other mammalian sequence entries, part 30. 3353. gbmam31.seq - Other mammalian sequence entries, part 31. 3354. gbmam32.seq - Other mammalian sequence entries, part 32. 3355. gbmam33.seq - Other mammalian sequence entries, part 33. 3356. gbmam34.seq - Other mammalian sequence entries, part 34. 3357. gbmam35.seq - Other mammalian sequence entries, part 35. 3358. gbmam36.seq - Other mammalian sequence entries, part 36. 3359. gbmam37.seq - Other mammalian sequence entries, part 37. 3360. gbmam38.seq - Other mammalian sequence entries, part 38. 3361. gbmam39.seq - Other mammalian sequence entries, part 39. 3362. gbmam4.seq - Other mammalian sequence entries, part 4. 3363. gbmam40.seq - Other mammalian sequence entries, part 40. 3364. gbmam41.seq - Other mammalian sequence entries, part 41. 3365. gbmam42.seq - Other mammalian sequence entries, part 42. 3366. gbmam43.seq - Other mammalian sequence entries, part 43. 3367. gbmam44.seq - Other mammalian sequence entries, part 44. 3368. gbmam45.seq - Other mammalian sequence entries, part 45. 3369. gbmam46.seq - Other mammalian sequence entries, part 46. 3370. gbmam47.seq - Other mammalian sequence entries, part 47. 3371. gbmam48.seq - Other mammalian sequence entries, part 48. 3372. gbmam49.seq - Other mammalian sequence entries, part 49. 3373. gbmam5.seq - Other mammalian sequence entries, part 5. 3374. gbmam50.seq - Other mammalian sequence entries, part 50. 3375. gbmam51.seq - Other mammalian sequence entries, part 51. 3376. gbmam52.seq - Other mammalian sequence entries, part 52. 3377. gbmam53.seq - Other mammalian sequence entries, part 53. 3378. gbmam54.seq - Other mammalian sequence entries, part 54. 3379. gbmam55.seq - Other mammalian sequence entries, part 55. 3380. gbmam56.seq - Other mammalian sequence entries, part 56. 3381. gbmam57.seq - Other mammalian sequence entries, part 57. 3382. gbmam58.seq - Other mammalian sequence entries, part 58. 3383. gbmam59.seq - Other mammalian sequence entries, part 59. 3384. gbmam6.seq - Other mammalian sequence entries, part 6. 3385. gbmam60.seq - Other mammalian sequence entries, part 60. 3386. gbmam61.seq - Other mammalian sequence entries, part 61. 3387. gbmam62.seq - Other mammalian sequence entries, part 62. 3388. gbmam63.seq - Other mammalian sequence entries, part 63. 3389. gbmam64.seq - Other mammalian sequence entries, part 64. 3390. gbmam65.seq - Other mammalian sequence entries, part 65. 3391. gbmam66.seq - Other mammalian sequence entries, part 66. 3392. gbmam67.seq - Other mammalian sequence entries, part 67. 3393. gbmam68.seq - Other mammalian sequence entries, part 68. 3394. gbmam69.seq - Other mammalian sequence entries, part 69. 3395. gbmam7.seq - Other mammalian sequence entries, part 7. 3396. gbmam70.seq - Other mammalian sequence entries, part 70. 3397. gbmam71.seq - Other mammalian sequence entries, part 71. 3398. gbmam72.seq - Other mammalian sequence entries, part 72. 3399. gbmam73.seq - Other mammalian sequence entries, part 73. 3400. gbmam74.seq - Other mammalian sequence entries, part 74. 3401. gbmam75.seq - Other mammalian sequence entries, part 75. 3402. gbmam76.seq - Other mammalian sequence entries, part 76. 3403. gbmam77.seq - Other mammalian sequence entries, part 77. 3404. gbmam78.seq - Other mammalian sequence entries, part 78. 3405. gbmam79.seq - Other mammalian sequence entries, part 79. 3406. gbmam8.seq - Other mammalian sequence entries, part 8. 3407. gbmam80.seq - Other mammalian sequence entries, part 80. 3408. gbmam81.seq - Other mammalian sequence entries, part 81. 3409. gbmam82.seq - Other mammalian sequence entries, part 82. 3410. gbmam83.seq - Other mammalian sequence entries, part 83. 3411. gbmam84.seq - Other mammalian sequence entries, part 84. 3412. gbmam85.seq - Other mammalian sequence entries, part 85. 3413. gbmam86.seq - Other mammalian sequence entries, part 86. 3414. gbmam87.seq - Other mammalian sequence entries, part 87. 3415. gbmam88.seq - Other mammalian sequence entries, part 88. 3416. gbmam89.seq - Other mammalian sequence entries, part 89. 3417. gbmam9.seq - Other mammalian sequence entries, part 9. 3418. gbmam90.seq - Other mammalian sequence entries, part 90. 3419. gbmam91.seq - Other mammalian sequence entries, part 91. 3420. gbmam92.seq - Other mammalian sequence entries, part 92. 3421. gbmam93.seq - Other mammalian sequence entries, part 93. 3422. gbmam94.seq - Other mammalian sequence entries, part 94. 3423. gbmam95.seq - Other mammalian sequence entries, part 95. 3424. gbmam96.seq - Other mammalian sequence entries, part 96. 3425. gbmam97.seq - Other mammalian sequence entries, part 97. 3426. gbmam98.seq - Other mammalian sequence entries, part 98. 3427. gbmam99.seq - Other mammalian sequence entries, part 99. 3428. gbnew.txt - Accession numbers of entries new since the previous release. 3429. gbpat1.seq - Patent sequence entries, part 1. 3430. gbpat10.seq - Patent sequence entries, part 10. 3431. gbpat11.seq - Patent sequence entries, part 11. 3432. gbpat12.seq - Patent sequence entries, part 12. 3433. gbpat13.seq - Patent sequence entries, part 13. 3434. gbpat14.seq - Patent sequence entries, part 14. 3435. gbpat15.seq - Patent sequence entries, part 15. 3436. gbpat16.seq - Patent sequence entries, part 16. 3437. gbpat17.seq - Patent sequence entries, part 17. 3438. gbpat18.seq - Patent sequence entries, part 18. 3439. gbpat19.seq - Patent sequence entries, part 19. 3440. gbpat2.seq - Patent sequence entries, part 2. 3441. gbpat20.seq - Patent sequence entries, part 20. 3442. gbpat21.seq - Patent sequence entries, part 21. 3443. gbpat22.seq - Patent sequence entries, part 22. 3444. gbpat23.seq - Patent sequence entries, part 23. 3445. gbpat24.seq - Patent sequence entries, part 24. 3446. gbpat25.seq - Patent sequence entries, part 25. 3447. gbpat26.seq - Patent sequence entries, part 26. 3448. gbpat27.seq - Patent sequence entries, part 27. 3449. gbpat28.seq - Patent sequence entries, part 28. 3450. gbpat29.seq - Patent sequence entries, part 29. 3451. gbpat3.seq - Patent sequence entries, part 3. 3452. gbpat30.seq - Patent sequence entries, part 30. 3453. gbpat31.seq - Patent sequence entries, part 31. 3454. gbpat32.seq - Patent sequence entries, part 32. 3455. gbpat33.seq - Patent sequence entries, part 33. 3456. gbpat34.seq - Patent sequence entries, part 34. 3457. gbpat35.seq - Patent sequence entries, part 35. 3458. gbpat36.seq - Patent sequence entries, part 36. 3459. gbpat37.seq - Patent sequence entries, part 37. 3460. gbpat38.seq - Patent sequence entries, part 38. 3461. gbpat39.seq - Patent sequence entries, part 39. 3462. gbpat4.seq - Patent sequence entries, part 4. 3463. gbpat40.seq - Patent sequence entries, part 40. 3464. gbpat41.seq - Patent sequence entries, part 41. 3465. gbpat42.seq - Patent sequence entries, part 42. 3466. gbpat43.seq - Patent sequence entries, part 43. 3467. gbpat44.seq - Patent sequence entries, part 44. 3468. gbpat45.seq - Patent sequence entries, part 45. 3469. gbpat46.seq - Patent sequence entries, part 46. 3470. gbpat47.seq - Patent sequence entries, part 47. 3471. gbpat48.seq - Patent sequence entries, part 48. 3472. gbpat49.seq - Patent sequence entries, part 49. 3473. gbpat5.seq - Patent sequence entries, part 5. 3474. gbpat50.seq - Patent sequence entries, part 50. 3475. gbpat51.seq - Patent sequence entries, part 51. 3476. gbpat52.seq - Patent sequence entries, part 52. 3477. gbpat53.seq - Patent sequence entries, part 53. 3478. gbpat54.seq - Patent sequence entries, part 54. 3479. gbpat55.seq - Patent sequence entries, part 55. 3480. gbpat56.seq - Patent sequence entries, part 56. 3481. gbpat57.seq - Patent sequence entries, part 57. 3482. gbpat58.seq - Patent sequence entries, part 58. 3483. gbpat59.seq - Patent sequence entries, part 59. 3484. gbpat6.seq - Patent sequence entries, part 6. 3485. gbpat60.seq - Patent sequence entries, part 60. 3486. gbpat61.seq - Patent sequence entries, part 61. 3487. gbpat62.seq - Patent sequence entries, part 62. 3488. gbpat63.seq - Patent sequence entries, part 63. 3489. gbpat64.seq - Patent sequence entries, part 64. 3490. gbpat65.seq - Patent sequence entries, part 65. 3491. gbpat66.seq - Patent sequence entries, part 66. 3492. gbpat67.seq - Patent sequence entries, part 67. 3493. gbpat68.seq - Patent sequence entries, part 68. 3494. gbpat69.seq - Patent sequence entries, part 69. 3495. gbpat7.seq - Patent sequence entries, part 7. 3496. gbpat70.seq - Patent sequence entries, part 70. 3497. gbpat71.seq - Patent sequence entries, part 71. 3498. gbpat72.seq - Patent sequence entries, part 72. 3499. gbpat73.seq - Patent sequence entries, part 73. 3500. gbpat74.seq - Patent sequence entries, part 74. 3501. gbpat75.seq - Patent sequence entries, part 75. 3502. gbpat76.seq - Patent sequence entries, part 76. 3503. gbpat77.seq - Patent sequence entries, part 77. 3504. gbpat78.seq - Patent sequence entries, part 78. 3505. gbpat79.seq - Patent sequence entries, part 79. 3506. gbpat8.seq - Patent sequence entries, part 8. 3507. gbpat80.seq - Patent sequence entries, part 80. 3508. gbpat81.seq - Patent sequence entries, part 81. 3509. gbpat82.seq - Patent sequence entries, part 82. 3510. gbpat83.seq - Patent sequence entries, part 83. 3511. gbpat84.seq - Patent sequence entries, part 84. 3512. gbpat85.seq - Patent sequence entries, part 85. 3513. gbpat86.seq - Patent sequence entries, part 86. 3514. gbpat87.seq - Patent sequence entries, part 87. (Patched to pat86) 3515. gbpat9.seq - Patent sequence entries, part 9. 3516. gbphg1.seq - Phage sequence entries, part 1. 3517. gbphg2.seq - Phage sequence entries, part 2. 3518. gbphg3.seq - Phage sequence entries, part 3. 3519. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1. 3520. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10. 3521. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100. 3522. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000. 3523. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001. 3524. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002. 3525. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003. 3526. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004. 3527. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005. 3528. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006. 3529. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007. 3530. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008. 3531. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009. 3532. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101. 3533. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010. 3534. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011. 3535. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012. 3536. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013. 3537. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014. 3538. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015. 3539. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016. 3540. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017. 3541. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018. 3542. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019. 3543. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102. 3544. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020. 3545. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021. 3546. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022. 3547. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023. 3548. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024. 3549. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025. 3550. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026. 3551. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027. 3552. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028. 3553. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029. 3554. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103. 3555. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030. 3556. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031. 3557. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032. 3558. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033. 3559. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034. 3560. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035. 3561. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036. 3562. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037. 3563. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038. 3564. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039. 3565. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104. 3566. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040. 3567. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041. 3568. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042. 3569. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043. 3570. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044. 3571. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045. 3572. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046. 3573. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047. 3574. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048. 3575. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049. 3576. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105. 3577. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050. 3578. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051. 3579. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052. 3580. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053. 3581. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054. 3582. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055. 3583. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056. 3584. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057. 3585. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058. 3586. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059. 3587. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106. 3588. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060. 3589. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061. 3590. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062. 3591. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063. 3592. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064. 3593. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065. 3594. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066. 3595. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067. 3596. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068. 3597. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069. 3598. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107. 3599. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070. 3600. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071. 3601. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072. 3602. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073. 3603. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074. 3604. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075. 3605. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076. 3606. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077. 3607. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078. 3608. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079. 3609. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108. 3610. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080. 3611. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081. 3612. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082. 3613. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083. 3614. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084. 3615. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085. 3616. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086. 3617. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087. 3618. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088. 3619. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089. 3620. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109. 3621. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090. 3622. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091. 3623. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092. 3624. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093. 3625. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094. 3626. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095. 3627. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096. 3628. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097. 3629. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098. 3630. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099. 3631. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11. 3632. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110. 3633. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100. 3634. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101. 3635. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102. 3636. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103. 3637. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104. 3638. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105. 3639. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106. 3640. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107. 3641. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108. 3642. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109. 3643. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111. 3644. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110. 3645. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111. 3646. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112. 3647. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113. 3648. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114. 3649. gbpln1115.seq - Plant sequence entries (including fungi and algae), part 1115. 3650. gbpln1116.seq - Plant sequence entries (including fungi and algae), part 1116. 3651. gbpln1117.seq - Plant sequence entries (including fungi and algae), part 1117. 3652. gbpln1118.seq - Plant sequence entries (including fungi and algae), part 1118. 3653. gbpln1119.seq - Plant sequence entries (including fungi and algae), part 1119. 3654. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112. 3655. gbpln1120.seq - Plant sequence entries (including fungi and algae), part 1120. 3656. gbpln1121.seq - Plant sequence entries (including fungi and algae), part 1121. 3657. gbpln1122.seq - Plant sequence entries (including fungi and algae), part 1122. 3658. gbpln1123.seq - Plant sequence entries (including fungi and algae), part 1123. 3659. gbpln1124.seq - Plant sequence entries (including fungi and algae), part 1124. 3660. gbpln1125.seq - Plant sequence entries (including fungi and algae), part 1125. 3661. gbpln1126.seq - Plant sequence entries (including fungi and algae), part 1126. 3662. gbpln1127.seq - Plant sequence entries (including fungi and algae), part 1127. 3663. gbpln1128.seq - Plant sequence entries (including fungi and algae), part 1128. 3664. gbpln1129.seq - Plant sequence entries (including fungi and algae), part 1129. 3665. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113. 3666. gbpln1130.seq - Plant sequence entries (including fungi and algae), part 1130. 3667. gbpln1131.seq - Plant sequence entries (including fungi and algae), part 1131. 3668. gbpln1132.seq - Plant sequence entries (including fungi and algae), part 1132. 3669. gbpln1133.seq - Plant sequence entries (including fungi and algae), part 1133. 3670. gbpln1134.seq - Plant sequence entries (including fungi and algae), part 1134. 3671. gbpln1135.seq - Plant sequence entries (including fungi and algae), part 1135. 3672. gbpln1136.seq - Plant sequence entries (including fungi and algae), part 1136. 3673. gbpln1137.seq - Plant sequence entries (including fungi and algae), part 1137. 3674. gbpln1138.seq - Plant sequence entries (including fungi and algae), part 1138. 3675. gbpln1139.seq - Plant sequence entries (including fungi and algae), part 1139. 3676. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114. 3677. gbpln1140.seq - Plant sequence entries (including fungi and algae), part 1140. 3678. gbpln1141.seq - Plant sequence entries (including fungi and algae), part 1141. 3679. gbpln1142.seq - Plant sequence entries (including fungi and algae), part 1142. 3680. gbpln1143.seq - Plant sequence entries (including fungi and algae), part 1143. 3681. gbpln1144.seq - Plant sequence entries (including fungi and algae), part 1144. 3682. gbpln1145.seq - Plant sequence entries (including fungi and algae), part 1145. 3683. gbpln1146.seq - Plant sequence entries (including fungi and algae), part 1146. 3684. gbpln1147.seq - Plant sequence entries (including fungi and algae), part 1147. 3685. gbpln1148.seq - Plant sequence entries (including fungi and algae), part 1148. 3686. gbpln1149.seq - Plant sequence entries (including fungi and algae), part 1149. 3687. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115. 3688. gbpln1150.seq - Plant sequence entries (including fungi and algae), part 1150. 3689. gbpln1151.seq - Plant sequence entries (including fungi and algae), part 1151. 3690. gbpln1152.seq - Plant sequence entries (including fungi and algae), part 1152. 3691. gbpln1153.seq - Plant sequence entries (including fungi and algae), part 1153. 3692. gbpln1154.seq - Plant sequence entries (including fungi and algae), part 1154. 3693. gbpln1155.seq - Plant sequence entries (including fungi and algae), part 1155. 3694. gbpln1156.seq - Plant sequence entries (including fungi and algae), part 1156. 3695. gbpln1157.seq - Plant sequence entries (including fungi and algae), part 1157. 3696. gbpln1158.seq - Plant sequence entries (including fungi and algae), part 1158. 3697. gbpln1159.seq - Plant sequence entries (including fungi and algae), part 1159. 3698. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116. 3699. gbpln1160.seq - Plant sequence entries (including fungi and algae), part 1160. 3700. gbpln1161.seq - Plant sequence entries (including fungi and algae), part 1161. 3701. gbpln1162.seq - Plant sequence entries (including fungi and algae), part 1162. 3702. gbpln1163.seq - Plant sequence entries (including fungi and algae), part 1163. 3703. gbpln1164.seq - Plant sequence entries (including fungi and algae), part 1164. 3704. gbpln1165.seq - Plant sequence entries (including fungi and algae), part 1165. 3705. gbpln1166.seq - Plant sequence entries (including fungi and algae), part 1166. 3706. gbpln1167.seq - Plant sequence entries (including fungi and algae), part 1167. 3707. gbpln1168.seq - Plant sequence entries (including fungi and algae), part 1168. 3708. gbpln1169.seq - Plant sequence entries (including fungi and algae), part 1169. 3709. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117. 3710. gbpln1170.seq - Plant sequence entries (including fungi and algae), part 1170. 3711. gbpln1171.seq - Plant sequence entries (including fungi and algae), part 1171. 3712. gbpln1172.seq - Plant sequence entries (including fungi and algae), part 1172. 3713. gbpln1173.seq - Plant sequence entries (including fungi and algae), part 1173. 3714. gbpln1174.seq - Plant sequence entries (including fungi and algae), part 1174. 3715. gbpln1175.seq - Plant sequence entries (including fungi and algae), part 1175. 3716. gbpln1176.seq - Plant sequence entries (including fungi and algae), part 1176. 3717. gbpln1177.seq - Plant sequence entries (including fungi and algae), part 1177. 3718. gbpln1178.seq - Plant sequence entries (including fungi and algae), part 1178. 3719. gbpln1179.seq - Plant sequence entries (including fungi and algae), part 1179. 3720. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118. 3721. gbpln1180.seq - Plant sequence entries (including fungi and algae), part 1180. 3722. gbpln1181.seq - Plant sequence entries (including fungi and algae), part 1181. 3723. gbpln1182.seq - Plant sequence entries (including fungi and algae), part 1182. 3724. gbpln1183.seq - Plant sequence entries (including fungi and algae), part 1183. 3725. gbpln1184.seq - Plant sequence entries (including fungi and algae), part 1184. 3726. gbpln1185.seq - Plant sequence entries (including fungi and algae), part 1185. 3727. gbpln1186.seq - Plant sequence entries (including fungi and algae), part 1186. 3728. gbpln1187.seq - Plant sequence entries (including fungi and algae), part 1187. 3729. gbpln1188.seq - Plant sequence entries (including fungi and algae), part 1188. 3730. gbpln1189.seq - Plant sequence entries (including fungi and algae), part 1189. 3731. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119. 3732. gbpln1190.seq - Plant sequence entries (including fungi and algae), part 1190. 3733. gbpln1191.seq - Plant sequence entries (including fungi and algae), part 1191. 3734. gbpln1192.seq - Plant sequence entries (including fungi and algae), part 1192. 3735. gbpln1193.seq - Plant sequence entries (including fungi and algae), part 1193. 3736. gbpln1194.seq - Plant sequence entries (including fungi and algae), part 1194. 3737. gbpln1195.seq - Plant sequence entries (including fungi and algae), part 1195. 3738. gbpln1196.seq - Plant sequence entries (including fungi and algae), part 1196. 3739. gbpln1197.seq - Plant sequence entries (including fungi and algae), part 1197. 3740. gbpln1198.seq - Plant sequence entries (including fungi and algae), part 1198. 3741. gbpln1199.seq - Plant sequence entries (including fungi and algae), part 1199. 3742. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12. 3743. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120. 3744. gbpln1200.seq - Plant sequence entries (including fungi and algae), part 1200. 3745. gbpln1201.seq - Plant sequence entries (including fungi and algae), part 1201. 3746. gbpln1202.seq - Plant sequence entries (including fungi and algae), part 1202. 3747. gbpln1203.seq - Plant sequence entries (including fungi and algae), part 1203. 3748. gbpln1204.seq - Plant sequence entries (including fungi and algae), part 1204. 3749. gbpln1205.seq - Plant sequence entries (including fungi and algae), part 1205. 3750. gbpln1206.seq - Plant sequence entries (including fungi and algae), part 1206. 3751. gbpln1207.seq - Plant sequence entries (including fungi and algae), part 1207. 3752. gbpln1208.seq - Plant sequence entries (including fungi and algae), part 1208. 3753. gbpln1209.seq - Plant sequence entries (including fungi and algae), part 1209. 3754. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121. 3755. gbpln1210.seq - Plant sequence entries (including fungi and algae), part 1210. 3756. gbpln1211.seq - Plant sequence entries (including fungi and algae), part 1211. 3757. gbpln1212.seq - Plant sequence entries (including fungi and algae), part 1212. 3758. gbpln1213.seq - Plant sequence entries (including fungi and algae), part 1213. 3759. gbpln1214.seq - Plant sequence entries (including fungi and algae), part 1214. 3760. gbpln1215.seq - Plant sequence entries (including fungi and algae), part 1215. 3761. gbpln1216.seq - Plant sequence entries (including fungi and algae), part 1216. 3762. gbpln1217.seq - Plant sequence entries (including fungi and algae), part 1217. 3763. gbpln1218.seq - Plant sequence entries (including fungi and algae), part 1218. 3764. gbpln1219.seq - Plant sequence entries (including fungi and algae), part 1219. 3765. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122. 3766. gbpln1220.seq - Plant sequence entries (including fungi and algae), part 1220. 3767. gbpln1221.seq - Plant sequence entries (including fungi and algae), part 1221. 3768. gbpln1222.seq - Plant sequence entries (including fungi and algae), part 1222. 3769. gbpln1223.seq - Plant sequence entries (including fungi and algae), part 1223. 3770. gbpln1224.seq - Plant sequence entries (including fungi and algae), part 1224. 3771. gbpln1225.seq - Plant sequence entries (including fungi and algae), part 1225. 3772. gbpln1226.seq - Plant sequence entries (including fungi and algae), part 1226. 3773. gbpln1227.seq - Plant sequence entries (including fungi and algae), part 1227. 3774. gbpln1228.seq - Plant sequence entries (including fungi and algae), part 1228. 3775. gbpln1229.seq - Plant sequence entries (including fungi and algae), part 1229. 3776. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123. 3777. gbpln1230.seq - Plant sequence entries (including fungi and algae), part 1230. 3778. gbpln1231.seq - Plant sequence entries (including fungi and algae), part 1231. 3779. gbpln1232.seq - Plant sequence entries (including fungi and algae), part 1232. 3780. gbpln1233.seq - Plant sequence entries (including fungi and algae), part 1233. 3781. gbpln1234.seq - Plant sequence entries (including fungi and algae), part 1234. 3782. gbpln1235.seq - Plant sequence entries (including fungi and algae), part 1235. 3783. gbpln1236.seq - Plant sequence entries (including fungi and algae), part 1236. 3784. gbpln1237.seq - Plant sequence entries (including fungi and algae), part 1237. 3785. gbpln1238.seq - Plant sequence entries (including fungi and algae), part 1238. 3786. gbpln1239.seq - Plant sequence entries (including fungi and algae), part 1239. 3787. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124. 3788. gbpln1240.seq - Plant sequence entries (including fungi and algae), part 1240. 3789. gbpln1241.seq - Plant sequence entries (including fungi and algae), part 1241. 3790. gbpln1242.seq - Plant sequence entries (including fungi and algae), part 1242. 3791. gbpln1243.seq - Plant sequence entries (including fungi and algae), part 1243. 3792. gbpln1244.seq - Plant sequence entries (including fungi and algae), part 1244. 3793. gbpln1245.seq - Plant sequence entries (including fungi and algae), part 1245. 3794. gbpln1246.seq - Plant sequence entries (including fungi and algae), part 1246. 3795. gbpln1247.seq - Plant sequence entries (including fungi and algae), part 1247. 3796. gbpln1248.seq - Plant sequence entries (including fungi and algae), part 1248. 3797. gbpln1249.seq - Plant sequence entries (including fungi and algae), part 1249. 3798. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125. 3799. gbpln1250.seq - Plant sequence entries (including fungi and algae), part 1250. 3800. gbpln1251.seq - Plant sequence entries (including fungi and algae), part 1251. 3801. gbpln1252.seq - Plant sequence entries (including fungi and algae), part 1252. 3802. gbpln1253.seq - Plant sequence entries (including fungi and algae), part 1253. 3803. gbpln1254.seq - Plant sequence entries (including fungi and algae), part 1254. 3804. gbpln1255.seq - Plant sequence entries (including fungi and algae), part 1255. 3805. gbpln1256.seq - Plant sequence entries (including fungi and algae), part 1256. 3806. gbpln1257.seq - Plant sequence entries (including fungi and algae), part 1257. 3807. gbpln1258.seq - Plant sequence entries (including fungi and algae), part 1258. 3808. gbpln1259.seq - Plant sequence entries (including fungi and algae), part 1259. 3809. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126. 3810. gbpln1260.seq - Plant sequence entries (including fungi and algae), part 1260. 3811. gbpln1261.seq - Plant sequence entries (including fungi and algae), part 1261. 3812. gbpln1262.seq - Plant sequence entries (including fungi and algae), part 1262. 3813. gbpln1263.seq - Plant sequence entries (including fungi and algae), part 1263. 3814. gbpln1264.seq - Plant sequence entries (including fungi and algae), part 1264. 3815. gbpln1265.seq - Plant sequence entries (including fungi and algae), part 1265. 3816. gbpln1266.seq - Plant sequence entries (including fungi and algae), part 1266. 3817. gbpln1267.seq - Plant sequence entries (including fungi and algae), part 1267. 3818. gbpln1268.seq - Plant sequence entries (including fungi and algae), part 1268. 3819. gbpln1269.seq - Plant sequence entries (including fungi and algae), part 1269. 3820. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127. 3821. gbpln1270.seq - Plant sequence entries (including fungi and algae), part 1270. 3822. gbpln1271.seq - Plant sequence entries (including fungi and algae), part 1271. 3823. gbpln1272.seq - Plant sequence entries (including fungi and algae), part 1272. 3824. gbpln1273.seq - Plant sequence entries (including fungi and algae), part 1273. 3825. gbpln1274.seq - Plant sequence entries (including fungi and algae), part 1274. 3826. gbpln1275.seq - Plant sequence entries (including fungi and algae), part 1275. 3827. gbpln1276.seq - Plant sequence entries (including fungi and algae), part 1276. 3828. gbpln1277.seq - Plant sequence entries (including fungi and algae), part 1277. 3829. gbpln1278.seq - Plant sequence entries (including fungi and algae), part 1278. 3830. gbpln1279.seq - Plant sequence entries (including fungi and algae), part 1279. 3831. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128. 3832. gbpln1280.seq - Plant sequence entries (including fungi and algae), part 1280. 3833. gbpln1281.seq - Plant sequence entries (including fungi and algae), part 1281. 3834. gbpln1282.seq - Plant sequence entries (including fungi and algae), part 1282. 3835. gbpln1283.seq - Plant sequence entries (including fungi and algae), part 1283. 3836. gbpln1284.seq - Plant sequence entries (including fungi and algae), part 1284. 3837. gbpln1285.seq - Plant sequence entries (including fungi and algae), part 1285. 3838. gbpln1286.seq - Plant sequence entries (including fungi and algae), part 1286. 3839. gbpln1287.seq - Plant sequence entries (including fungi and algae), part 1287. 3840. gbpln1288.seq - Plant sequence entries (including fungi and algae), part 1288. 3841. gbpln1289.seq - Plant sequence entries (including fungi and algae), part 1289. 3842. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129. 3843. gbpln1290.seq - Plant sequence entries (including fungi and algae), part 1290. 3844. gbpln1291.seq - Plant sequence entries (including fungi and algae), part 1291. 3845. gbpln1292.seq - Plant sequence entries (including fungi and algae), part 1292. 3846. gbpln1293.seq - Plant sequence entries (including fungi and algae), part 1293. 3847. gbpln1294.seq - Plant sequence entries (including fungi and algae), part 1294. 3848. gbpln1295.seq - Plant sequence entries (including fungi and algae), part 1295. 3849. gbpln1296.seq - Plant sequence entries (including fungi and algae), part 1296. 3850. gbpln1297.seq - Plant sequence entries (including fungi and algae), part 1297. 3851. gbpln1298.seq - Plant sequence entries (including fungi and algae), part 1298. 3852. gbpln1299.seq - Plant sequence entries (including fungi and algae), part 1299. 3853. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13. 3854. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130. 3855. gbpln1300.seq - Plant sequence entries (including fungi and algae), part 1300. 3856. gbpln1301.seq - Plant sequence entries (including fungi and algae), part 1301. 3857. gbpln1302.seq - Plant sequence entries (including fungi and algae), part 1302. 3858. gbpln1303.seq - Plant sequence entries (including fungi and algae), part 1303. 3859. gbpln1304.seq - Plant sequence entries (including fungi and algae), part 1304. 3860. gbpln1305.seq - Plant sequence entries (including fungi and algae), part 1305. 3861. gbpln1306.seq - Plant sequence entries (including fungi and algae), part 1306. 3862. gbpln1307.seq - Plant sequence entries (including fungi and algae), part 1307. 3863. gbpln1308.seq - Plant sequence entries (including fungi and algae), part 1308. 3864. gbpln1309.seq - Plant sequence entries (including fungi and algae), part 1309. 3865. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131. 3866. gbpln1310.seq - Plant sequence entries (including fungi and algae), part 1310. 3867. gbpln1311.seq - Plant sequence entries (including fungi and algae), part 1311. 3868. gbpln1312.seq - Plant sequence entries (including fungi and algae), part 1312. 3869. gbpln1313.seq - Plant sequence entries (including fungi and algae), part 1313. 3870. gbpln1314.seq - Plant sequence entries (including fungi and algae), part 1314. 3871. gbpln1315.seq - Plant sequence entries (including fungi and algae), part 1315. 3872. gbpln1316.seq - Plant sequence entries (including fungi and algae), part 1316. 3873. gbpln1317.seq - Plant sequence entries (including fungi and algae), part 1317. 3874. gbpln1318.seq - Plant sequence entries (including fungi and algae), part 1318. 3875. gbpln1319.seq - Plant sequence entries (including fungi and algae), part 1319. 3876. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132. 3877. gbpln1320.seq - Plant sequence entries (including fungi and algae), part 1320. 3878. gbpln1321.seq - Plant sequence entries (including fungi and algae), part 1321. 3879. gbpln1322.seq - Plant sequence entries (including fungi and algae), part 1322. 3880. gbpln1323.seq - Plant sequence entries (including fungi and algae), part 1323. 3881. gbpln1324.seq - Plant sequence entries (including fungi and algae), part 1324. 3882. gbpln1325.seq - Plant sequence entries (including fungi and algae), part 1325. 3883. gbpln1326.seq - Plant sequence entries (including fungi and algae), part 1326. 3884. gbpln1327.seq - Plant sequence entries (including fungi and algae), part 1327. 3885. gbpln1328.seq - Plant sequence entries (including fungi and algae), part 1328. 3886. gbpln1329.seq - Plant sequence entries (including fungi and algae), part 1329. 3887. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133. 3888. gbpln1330.seq - Plant sequence entries (including fungi and algae), part 1330. 3889. gbpln1331.seq - Plant sequence entries (including fungi and algae), part 1331. 3890. gbpln1332.seq - Plant sequence entries (including fungi and algae), part 1332. 3891. gbpln1333.seq - Plant sequence entries (including fungi and algae), part 1333. 3892. gbpln1334.seq - Plant sequence entries (including fungi and algae), part 1334. 3893. gbpln1335.seq - Plant sequence entries (including fungi and algae), part 1335. 3894. gbpln1336.seq - Plant sequence entries (including fungi and algae), part 1336. 3895. gbpln1337.seq - Plant sequence entries (including fungi and algae), part 1337. 3896. gbpln1338.seq - Plant sequence entries (including fungi and algae), part 1338. 3897. gbpln1339.seq - Plant sequence entries (including fungi and algae), part 1339. 3898. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134. 3899. gbpln1340.seq - Plant sequence entries (including fungi and algae), part 1340. 3900. gbpln1341.seq - Plant sequence entries (including fungi and algae), part 1341. 3901. gbpln1342.seq - Plant sequence entries (including fungi and algae), part 1342. 3902. gbpln1343.seq - Plant sequence entries (including fungi and algae), part 1343. 3903. gbpln1344.seq - Plant sequence entries (including fungi and algae), part 1344. 3904. gbpln1345.seq - Plant sequence entries (including fungi and algae), part 1345. 3905. gbpln1346.seq - Plant sequence entries (including fungi and algae), part 1346. 3906. gbpln1347.seq - Plant sequence entries (including fungi and algae), part 1347. 3907. gbpln1348.seq - Plant sequence entries (including fungi and algae), part 1348. 3908. gbpln1349.seq - Plant sequence entries (including fungi and algae), part 1349. 3909. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135. 3910. gbpln1350.seq - Plant sequence entries (including fungi and algae), part 1350. 3911. gbpln1351.seq - Plant sequence entries (including fungi and algae), part 1351. 3912. gbpln1352.seq - Plant sequence entries (including fungi and algae), part 1352. 3913. gbpln1353.seq - Plant sequence entries (including fungi and algae), part 1353. 3914. gbpln1354.seq - Plant sequence entries (including fungi and algae), part 1354. 3915. gbpln1355.seq - Plant sequence entries (including fungi and algae), part 1355. 3916. gbpln1356.seq - Plant sequence entries (including fungi and algae), part 1356. 3917. gbpln1357.seq - Plant sequence entries (including fungi and algae), part 1357. 3918. gbpln1358.seq - Plant sequence entries (including fungi and algae), part 1358. 3919. gbpln1359.seq - Plant sequence entries (including fungi and algae), part 1359. 3920. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136. 3921. gbpln1360.seq - Plant sequence entries (including fungi and algae), part 1360. 3922. gbpln1361.seq - Plant sequence entries (including fungi and algae), part 1361. 3923. gbpln1362.seq - Plant sequence entries (including fungi and algae), part 1362. 3924. gbpln1363.seq - Plant sequence entries (including fungi and algae), part 1363. 3925. gbpln1364.seq - Plant sequence entries (including fungi and algae), part 1364. 3926. gbpln1365.seq - Plant sequence entries (including fungi and algae), part 1365. 3927. gbpln1366.seq - Plant sequence entries (including fungi and algae), part 1366. 3928. gbpln1367.seq - Plant sequence entries (including fungi and algae), part 1367. 3929. gbpln1368.seq - Plant sequence entries (including fungi and algae), part 1368. 3930. gbpln1369.seq - Plant sequence entries (including fungi and algae), part 1369. 3931. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137. 3932. gbpln1370.seq - Plant sequence entries (including fungi and algae), part 1370. 3933. gbpln1371.seq - Plant sequence entries (including fungi and algae), part 1371. 3934. gbpln1372.seq - Plant sequence entries (including fungi and algae), part 1372. 3935. gbpln1373.seq - Plant sequence entries (including fungi and algae), part 1373. 3936. gbpln1374.seq - Plant sequence entries (including fungi and algae), part 1374. 3937. gbpln1375.seq - Plant sequence entries (including fungi and algae), part 1375. 3938. gbpln1376.seq - Plant sequence entries (including fungi and algae), part 1376. 3939. gbpln1377.seq - Plant sequence entries (including fungi and algae), part 1377. 3940. gbpln1378.seq - Plant sequence entries (including fungi and algae), part 1378. 3941. gbpln1379.seq - Plant sequence entries (including fungi and algae), part 1379. 3942. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138. 3943. gbpln1380.seq - Plant sequence entries (including fungi and algae), part 1380. 3944. gbpln1381.seq - Plant sequence entries (including fungi and algae), part 1381. 3945. gbpln1382.seq - Plant sequence entries (including fungi and algae), part 1382. 3946. gbpln1383.seq - Plant sequence entries (including fungi and algae), part 1383. 3947. gbpln1384.seq - Plant sequence entries (including fungi and algae), part 1384. 3948. gbpln1385.seq - Plant sequence entries (including fungi and algae), part 1385. 3949. gbpln1386.seq - Plant sequence entries (including fungi and algae), part 1386. 3950. gbpln1387.seq - Plant sequence entries (including fungi and algae), part 1387. 3951. gbpln1388.seq - Plant sequence entries (including fungi and algae), part 1388. 3952. gbpln1389.seq - Plant sequence entries (including fungi and algae), part 1389. 3953. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139. 3954. gbpln1390.seq - Plant sequence entries (including fungi and algae), part 1390. 3955. gbpln1391.seq - Plant sequence entries (including fungi and algae), part 1391. 3956. gbpln1392.seq - Plant sequence entries (including fungi and algae), part 1392. 3957. gbpln1393.seq - Plant sequence entries (including fungi and algae), part 1393. 3958. gbpln1394.seq - Plant sequence entries (including fungi and algae), part 1394. 3959. gbpln1395.seq - Plant sequence entries (including fungi and algae), part 1395. 3960. gbpln1396.seq - Plant sequence entries (including fungi and algae), part 1396. 3961. gbpln1397.seq - Plant sequence entries (including fungi and algae), part 1397. 3962. gbpln1398.seq - Plant sequence entries (including fungi and algae), part 1398. 3963. gbpln1399.seq - Plant sequence entries (including fungi and algae), part 1399. 3964. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14. 3965. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140. 3966. gbpln1400.seq - Plant sequence entries (including fungi and algae), part 1400. 3967. gbpln1401.seq - Plant sequence entries (including fungi and algae), part 1401. 3968. gbpln1402.seq - Plant sequence entries (including fungi and algae), part 1402. 3969. gbpln1403.seq - Plant sequence entries (including fungi and algae), part 1403. 3970. gbpln1404.seq - Plant sequence entries (including fungi and algae), part 1404. 3971. gbpln1405.seq - Plant sequence entries (including fungi and algae), part 1405. 3972. gbpln1406.seq - Plant sequence entries (including fungi and algae), part 1406. 3973. gbpln1407.seq - Plant sequence entries (including fungi and algae), part 1407. 3974. gbpln1408.seq - Plant sequence entries (including fungi and algae), part 1408. 3975. gbpln1409.seq - Plant sequence entries (including fungi and algae), part 1409. 3976. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141. 3977. gbpln1410.seq - Plant sequence entries (including fungi and algae), part 1410. 3978. gbpln1411.seq - Plant sequence entries (including fungi and algae), part 1411. 3979. gbpln1412.seq - Plant sequence entries (including fungi and algae), part 1412. 3980. gbpln1413.seq - Plant sequence entries (including fungi and algae), part 1413. 3981. gbpln1414.seq - Plant sequence entries (including fungi and algae), part 1414. 3982. gbpln1415.seq - Plant sequence entries (including fungi and algae), part 1415. 3983. gbpln1416.seq - Plant sequence entries (including fungi and algae), part 1416. 3984. gbpln1417.seq - Plant sequence entries (including fungi and algae), part 1417. 3985. gbpln1418.seq - Plant sequence entries (including fungi and algae), part 1418. 3986. gbpln1419.seq - Plant sequence entries (including fungi and algae), part 1419. 3987. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142. 3988. gbpln1420.seq - Plant sequence entries (including fungi and algae), part 1420. 3989. gbpln1421.seq - Plant sequence entries (including fungi and algae), part 1421. 3990. gbpln1422.seq - Plant sequence entries (including fungi and algae), part 1422. 3991. gbpln1423.seq - Plant sequence entries (including fungi and algae), part 1423. 3992. gbpln1424.seq - Plant sequence entries (including fungi and algae), part 1424. 3993. gbpln1425.seq - Plant sequence entries (including fungi and algae), part 1425. 3994. gbpln1426.seq - Plant sequence entries (including fungi and algae), part 1426. 3995. gbpln1427.seq - Plant sequence entries (including fungi and algae), part 1427. 3996. gbpln1428.seq - Plant sequence entries (including fungi and algae), part 1428. 3997. gbpln1429.seq - Plant sequence entries (including fungi and algae), part 1429. 3998. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143. 3999. gbpln1430.seq - Plant sequence entries (including fungi and algae), part 1430. 4000. gbpln1431.seq - Plant sequence entries (including fungi and algae), part 1431. 4001. gbpln1432.seq - Plant sequence entries (including fungi and algae), part 1432. 4002. gbpln1433.seq - Plant sequence entries (including fungi and algae), part 1433. 4003. gbpln1434.seq - Plant sequence entries (including fungi and algae), part 1434. 4004. gbpln1435.seq - Plant sequence entries (including fungi and algae), part 1435. 4005. gbpln1436.seq - Plant sequence entries (including fungi and algae), part 1436. 4006. gbpln1437.seq - Plant sequence entries (including fungi and algae), part 1437. 4007. gbpln1438.seq - Plant sequence entries (including fungi and algae), part 1438. 4008. gbpln1439.seq - Plant sequence entries (including fungi and algae), part 1439. 4009. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144. 4010. gbpln1440.seq - Plant sequence entries (including fungi and algae), part 1440. 4011. gbpln1441.seq - Plant sequence entries (including fungi and algae), part 1441. 4012. gbpln1442.seq - Plant sequence entries (including fungi and algae), part 1442. 4013. gbpln1443.seq - Plant sequence entries (including fungi and algae), part 1443. 4014. gbpln1444.seq - Plant sequence entries (including fungi and algae), part 1444. 4015. gbpln1445.seq - Plant sequence entries (including fungi and algae), part 1445. 4016. gbpln1446.seq - Plant sequence entries (including fungi and algae), part 1446. 4017. gbpln1447.seq - Plant sequence entries (including fungi and algae), part 1447. 4018. gbpln1448.seq - Plant sequence entries (including fungi and algae), part 1448. 4019. gbpln1449.seq - Plant sequence entries (including fungi and algae), part 1449. 4020. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145. 4021. gbpln1450.seq - Plant sequence entries (including fungi and algae), part 1450. 4022. gbpln1451.seq - Plant sequence entries (including fungi and algae), part 1451. 4023. gbpln1452.seq - Plant sequence entries (including fungi and algae), part 1452. 4024. gbpln1453.seq - Plant sequence entries (including fungi and algae), part 1453. 4025. gbpln1454.seq - Plant sequence entries (including fungi and algae), part 1454. 4026. gbpln1455.seq - Plant sequence entries (including fungi and algae), part 1455. 4027. gbpln1456.seq - Plant sequence entries (including fungi and algae), part 1456. 4028. gbpln1457.seq - Plant sequence entries (including fungi and algae), part 1457. 4029. gbpln1458.seq - Plant sequence entries (including fungi and algae), part 1458. 4030. gbpln1459.seq - Plant sequence entries (including fungi and algae), part 1459. 4031. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146. 4032. gbpln1460.seq - Plant sequence entries (including fungi and algae), part 1460. 4033. gbpln1461.seq - Plant sequence entries (including fungi and algae), part 1461. 4034. gbpln1462.seq - Plant sequence entries (including fungi and algae), part 1462. 4035. gbpln1463.seq - Plant sequence entries (including fungi and algae), part 1463. 4036. gbpln1464.seq - Plant sequence entries (including fungi and algae), part 1464. 4037. gbpln1465.seq - Plant sequence entries (including fungi and algae), part 1465. 4038. gbpln1466.seq - Plant sequence entries (including fungi and algae), part 1466. 4039. gbpln1467.seq - Plant sequence entries (including fungi and algae), part 1467. 4040. gbpln1468.seq - Plant sequence entries (including fungi and algae), part 1468. 4041. gbpln1469.seq - Plant sequence entries (including fungi and algae), part 1469. 4042. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147. 4043. gbpln1470.seq - Plant sequence entries (including fungi and algae), part 1470. 4044. gbpln1471.seq - Plant sequence entries (including fungi and algae), part 1471. 4045. gbpln1472.seq - Plant sequence entries (including fungi and algae), part 1472. 4046. gbpln1473.seq - Plant sequence entries (including fungi and algae), part 1473. 4047. gbpln1474.seq - Plant sequence entries (including fungi and algae), part 1474. 4048. gbpln1475.seq - Plant sequence entries (including fungi and algae), part 1475. 4049. gbpln1476.seq - Plant sequence entries (including fungi and algae), part 1476. 4050. gbpln1477.seq - Plant sequence entries (including fungi and algae), part 1477. 4051. gbpln1478.seq - Plant sequence entries (including fungi and algae), part 1478. 4052. gbpln1479.seq - Plant sequence entries (including fungi and algae), part 1479. 4053. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148. 4054. gbpln1480.seq - Plant sequence entries (including fungi and algae), part 1480. 4055. gbpln1481.seq - Plant sequence entries (including fungi and algae), part 1481. 4056. gbpln1482.seq - Plant sequence entries (including fungi and algae), part 1482. 4057. gbpln1483.seq - Plant sequence entries (including fungi and algae), part 1483. 4058. gbpln1484.seq - Plant sequence entries (including fungi and algae), part 1484. 4059. gbpln1485.seq - Plant sequence entries (including fungi and algae), part 1485. 4060. gbpln1486.seq - Plant sequence entries (including fungi and algae), part 1486. 4061. gbpln1487.seq - Plant sequence entries (including fungi and algae), part 1487. 4062. gbpln1488.seq - Plant sequence entries (including fungi and algae), part 1488. 4063. gbpln1489.seq - Plant sequence entries (including fungi and algae), part 1489. 4064. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149. 4065. gbpln1490.seq - Plant sequence entries (including fungi and algae), part 1490. 4066. gbpln1491.seq - Plant sequence entries (including fungi and algae), part 1491. 4067. gbpln1492.seq - Plant sequence entries (including fungi and algae), part 1492. 4068. gbpln1493.seq - Plant sequence entries (including fungi and algae), part 1493. 4069. gbpln1494.seq - Plant sequence entries (including fungi and algae), part 1494. 4070. gbpln1495.seq - Plant sequence entries (including fungi and algae), part 1495. 4071. gbpln1496.seq - Plant sequence entries (including fungi and algae), part 1496. 4072. gbpln1497.seq - Plant sequence entries (including fungi and algae), part 1497. 4073. gbpln1498.seq - Plant sequence entries (including fungi and algae), part 1498. 4074. gbpln1499.seq - Plant sequence entries (including fungi and algae), part 1499. 4075. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15. 4076. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150. 4077. gbpln1500.seq - Plant sequence entries (including fungi and algae), part 1500. 4078. gbpln1501.seq - Plant sequence entries (including fungi and algae), part 1501. 4079. gbpln1502.seq - Plant sequence entries (including fungi and algae), part 1502. 4080. gbpln1503.seq - Plant sequence entries (including fungi and algae), part 1503. 4081. gbpln1504.seq - Plant sequence entries (including fungi and algae), part 1504. 4082. gbpln1505.seq - Plant sequence entries (including fungi and algae), part 1505. 4083. gbpln1506.seq - Plant sequence entries (including fungi and algae), part 1506. 4084. gbpln1507.seq - Plant sequence entries (including fungi and algae), part 1507. 4085. gbpln1508.seq - Plant sequence entries (including fungi and algae), part 1508. 4086. gbpln1509.seq - Plant sequence entries (including fungi and algae), part 1509. 4087. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151. 4088. gbpln1510.seq - Plant sequence entries (including fungi and algae), part 1510. 4089. gbpln1511.seq - Plant sequence entries (including fungi and algae), part 1511. 4090. gbpln1512.seq - Plant sequence entries (including fungi and algae), part 1512. 4091. gbpln1513.seq - Plant sequence entries (including fungi and algae), part 1513. 4092. gbpln1514.seq - Plant sequence entries (including fungi and algae), part 1514. 4093. gbpln1515.seq - Plant sequence entries (including fungi and algae), part 1515. 4094. gbpln1516.seq - Plant sequence entries (including fungi and algae), part 1516. 4095. gbpln1517.seq - Plant sequence entries (including fungi and algae), part 1517. 4096. gbpln1518.seq - Plant sequence entries (including fungi and algae), part 1518. 4097. gbpln1519.seq - Plant sequence entries (including fungi and algae), part 1519. 4098. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152. 4099. gbpln1520.seq - Plant sequence entries (including fungi and algae), part 1520. 4100. gbpln1521.seq - Plant sequence entries (including fungi and algae), part 1521. 4101. gbpln1522.seq - Plant sequence entries (including fungi and algae), part 1522. 4102. gbpln1523.seq - Plant sequence entries (including fungi and algae), part 1523. 4103. gbpln1524.seq - Plant sequence entries (including fungi and algae), part 1524. 4104. gbpln1525.seq - Plant sequence entries (including fungi and algae), part 1525. 4105. gbpln1526.seq - Plant sequence entries (including fungi and algae), part 1526. 4106. gbpln1527.seq - Plant sequence entries (including fungi and algae), part 1527. 4107. gbpln1528.seq - Plant sequence entries (including fungi and algae), part 1528. 4108. gbpln1529.seq - Plant sequence entries (including fungi and algae), part 1529. 4109. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153. 4110. gbpln1530.seq - Plant sequence entries (including fungi and algae), part 1530. 4111. gbpln1531.seq - Plant sequence entries (including fungi and algae), part 1531. 4112. gbpln1532.seq - Plant sequence entries (including fungi and algae), part 1532. 4113. gbpln1533.seq - Plant sequence entries (including fungi and algae), part 1533. 4114. gbpln1534.seq - Plant sequence entries (including fungi and algae), part 1534. 4115. gbpln1535.seq - Plant sequence entries (including fungi and algae), part 1535. 4116. gbpln1536.seq - Plant sequence entries (including fungi and algae), part 1536. 4117. gbpln1537.seq - Plant sequence entries (including fungi and algae), part 1537. 4118. gbpln1538.seq - Plant sequence entries (including fungi and algae), part 1538. 4119. gbpln1539.seq - Plant sequence entries (including fungi and algae), part 1539. 4120. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154. 4121. gbpln1540.seq - Plant sequence entries (including fungi and algae), part 1540. 4122. gbpln1541.seq - Plant sequence entries (including fungi and algae), part 1541. 4123. gbpln1542.seq - Plant sequence entries (including fungi and algae), part 1542. 4124. gbpln1543.seq - Plant sequence entries (including fungi and algae), part 1543. 4125. gbpln1544.seq - Plant sequence entries (including fungi and algae), part 1544. 4126. gbpln1545.seq - Plant sequence entries (including fungi and algae), part 1545. 4127. gbpln1546.seq - Plant sequence entries (including fungi and algae), part 1546. 4128. gbpln1547.seq - Plant sequence entries (including fungi and algae), part 1547. 4129. gbpln1548.seq - Plant sequence entries (including fungi and algae), part 1548. 4130. gbpln1549.seq - Plant sequence entries (including fungi and algae), part 1549. 4131. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155. 4132. gbpln1550.seq - Plant sequence entries (including fungi and algae), part 1550. 4133. gbpln1551.seq - Plant sequence entries (including fungi and algae), part 1551. 4134. gbpln1552.seq - Plant sequence entries (including fungi and algae), part 1552. 4135. gbpln1553.seq - Plant sequence entries (including fungi and algae), part 1553. 4136. gbpln1554.seq - Plant sequence entries (including fungi and algae), part 1554. 4137. gbpln1555.seq - Plant sequence entries (including fungi and algae), part 1555. 4138. gbpln1556.seq - Plant sequence entries (including fungi and algae), part 1556. 4139. gbpln1557.seq - Plant sequence entries (including fungi and algae), part 1557. 4140. gbpln1558.seq - Plant sequence entries (including fungi and algae), part 1558. 4141. gbpln1559.seq - Plant sequence entries (including fungi and algae), part 1559. 4142. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156. 4143. gbpln1560.seq - Plant sequence entries (including fungi and algae), part 1560. 4144. gbpln1561.seq - Plant sequence entries (including fungi and algae), part 1561. 4145. gbpln1562.seq - Plant sequence entries (including fungi and algae), part 1562. 4146. gbpln1563.seq - Plant sequence entries (including fungi and algae), part 1563. 4147. gbpln1564.seq - Plant sequence entries (including fungi and algae), part 1564. 4148. gbpln1565.seq - Plant sequence entries (including fungi and algae), part 1565. 4149. gbpln1566.seq - Plant sequence entries (including fungi and algae), part 1566. 4150. gbpln1567.seq - Plant sequence entries (including fungi and algae), part 1567. 4151. gbpln1568.seq - Plant sequence entries (including fungi and algae), part 1568. 4152. gbpln1569.seq - Plant sequence entries (including fungi and algae), part 1569. 4153. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157. 4154. gbpln1570.seq - Plant sequence entries (including fungi and algae), part 1570. 4155. gbpln1571.seq - Plant sequence entries (including fungi and algae), part 1571. 4156. gbpln1572.seq - Plant sequence entries (including fungi and algae), part 1572. 4157. gbpln1573.seq - Plant sequence entries (including fungi and algae), part 1573. 4158. gbpln1574.seq - Plant sequence entries (including fungi and algae), part 1574. 4159. gbpln1575.seq - Plant sequence entries (including fungi and algae), part 1575. 4160. gbpln1576.seq - Plant sequence entries (including fungi and algae), part 1576. 4161. gbpln1577.seq - Plant sequence entries (including fungi and algae), part 1577. 4162. gbpln1578.seq - Plant sequence entries (including fungi and algae), part 1578. 4163. gbpln1579.seq - Plant sequence entries (including fungi and algae), part 1579. 4164. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158. 4165. gbpln1580.seq - Plant sequence entries (including fungi and algae), part 1580. 4166. gbpln1581.seq - Plant sequence entries (including fungi and algae), part 1581. 4167. gbpln1582.seq - Plant sequence entries (including fungi and algae), part 1582. 4168. gbpln1583.seq - Plant sequence entries (including fungi and algae), part 1583. 4169. gbpln1584.seq - Plant sequence entries (including fungi and algae), part 1584. 4170. gbpln1585.seq - Plant sequence entries (including fungi and algae), part 1585. 4171. gbpln1586.seq - Plant sequence entries (including fungi and algae), part 1586. 4172. gbpln1587.seq - Plant sequence entries (including fungi and algae), part 1587. 4173. gbpln1588.seq - Plant sequence entries (including fungi and algae), part 1588. 4174. gbpln1589.seq - Plant sequence entries (including fungi and algae), part 1589. 4175. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159. 4176. gbpln1590.seq - Plant sequence entries (including fungi and algae), part 1590. 4177. gbpln1591.seq - Plant sequence entries (including fungi and algae), part 1591. 4178. gbpln1592.seq - Plant sequence entries (including fungi and algae), part 1592. 4179. gbpln1593.seq - Plant sequence entries (including fungi and algae), part 1593. 4180. gbpln1594.seq - Plant sequence entries (including fungi and algae), part 1594. 4181. gbpln1595.seq - Plant sequence entries (including fungi and algae), part 1595. 4182. gbpln1596.seq - Plant sequence entries (including fungi and algae), part 1596. 4183. gbpln1597.seq - Plant sequence entries (including fungi and algae), part 1597. 4184. gbpln1598.seq - Plant sequence entries (including fungi and algae), part 1598. 4185. gbpln1599.seq - Plant sequence entries (including fungi and algae), part 1599. 4186. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16. 4187. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160. 4188. gbpln1600.seq - Plant sequence entries (including fungi and algae), part 1600. 4189. gbpln1601.seq - Plant sequence entries (including fungi and algae), part 1601. 4190. gbpln1602.seq - Plant sequence entries (including fungi and algae), part 1602. 4191. gbpln1603.seq - Plant sequence entries (including fungi and algae), part 1603. 4192. gbpln1604.seq - Plant sequence entries (including fungi and algae), part 1604. 4193. gbpln1605.seq - Plant sequence entries (including fungi and algae), part 1605. 4194. gbpln1606.seq - Plant sequence entries (including fungi and algae), part 1606. 4195. gbpln1607.seq - Plant sequence entries (including fungi and algae), part 1607. 4196. gbpln1608.seq - Plant sequence entries (including fungi and algae), part 1608. 4197. gbpln1609.seq - Plant sequence entries (including fungi and algae), part 1609. 4198. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161. 4199. gbpln1610.seq - Plant sequence entries (including fungi and algae), part 1610. 4200. gbpln1611.seq - Plant sequence entries (including fungi and algae), part 1611. 4201. gbpln1612.seq - Plant sequence entries (including fungi and algae), part 1612. 4202. gbpln1613.seq - Plant sequence entries (including fungi and algae), part 1613. 4203. gbpln1614.seq - Plant sequence entries (including fungi and algae), part 1614. 4204. gbpln1615.seq - Plant sequence entries (including fungi and algae), part 1615. 4205. gbpln1616.seq - Plant sequence entries (including fungi and algae), part 1616. 4206. gbpln1617.seq - Plant sequence entries (including fungi and algae), part 1617. 4207. gbpln1618.seq - Plant sequence entries (including fungi and algae), part 1618. 4208. gbpln1619.seq - Plant sequence entries (including fungi and algae), part 1619. 4209. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162. 4210. gbpln1620.seq - Plant sequence entries (including fungi and algae), part 1620. 4211. gbpln1621.seq - Plant sequence entries (including fungi and algae), part 1621. 4212. gbpln1622.seq - Plant sequence entries (including fungi and algae), part 1622. 4213. gbpln1623.seq - Plant sequence entries (including fungi and algae), part 1623. 4214. gbpln1624.seq - Plant sequence entries (including fungi and algae), part 1624. 4215. gbpln1625.seq - Plant sequence entries (including fungi and algae), part 1625. 4216. gbpln1626.seq - Plant sequence entries (including fungi and algae), part 1626. 4217. gbpln1627.seq - Plant sequence entries (including fungi and algae), part 1627. 4218. gbpln1628.seq - Plant sequence entries (including fungi and algae), part 1628. 4219. gbpln1629.seq - Plant sequence entries (including fungi and algae), part 1629. 4220. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163. 4221. gbpln1630.seq - Plant sequence entries (including fungi and algae), part 1630. 4222. gbpln1631.seq - Plant sequence entries (including fungi and algae), part 1631. 4223. gbpln1632.seq - Plant sequence entries (including fungi and algae), part 1632. 4224. gbpln1633.seq - Plant sequence entries (including fungi and algae), part 1633. 4225. gbpln1634.seq - Plant sequence entries (including fungi and algae), part 1634. 4226. gbpln1635.seq - Plant sequence entries (including fungi and algae), part 1635. 4227. gbpln1636.seq - Plant sequence entries (including fungi and algae), part 1636. 4228. gbpln1637.seq - Plant sequence entries (including fungi and algae), part 1637. 4229. gbpln1638.seq - Plant sequence entries (including fungi and algae), part 1638. 4230. gbpln1639.seq - Plant sequence entries (including fungi and algae), part 1639. 4231. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164. 4232. gbpln1640.seq - Plant sequence entries (including fungi and algae), part 1640. 4233. gbpln1641.seq - Plant sequence entries (including fungi and algae), part 1641. 4234. gbpln1642.seq - Plant sequence entries (including fungi and algae), part 1642. 4235. gbpln1643.seq - Plant sequence entries (including fungi and algae), part 1643. 4236. gbpln1644.seq - Plant sequence entries (including fungi and algae), part 1644. 4237. gbpln1645.seq - Plant sequence entries (including fungi and algae), part 1645. 4238. gbpln1646.seq - Plant sequence entries (including fungi and algae), part 1646. 4239. gbpln1647.seq - Plant sequence entries (including fungi and algae), part 1647. 4240. gbpln1648.seq - Plant sequence entries (including fungi and algae), part 1648. 4241. gbpln1649.seq - Plant sequence entries (including fungi and algae), part 1649. 4242. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165. 4243. gbpln1650.seq - Plant sequence entries (including fungi and algae), part 1650. 4244. gbpln1651.seq - Plant sequence entries (including fungi and algae), part 1651. 4245. gbpln1652.seq - Plant sequence entries (including fungi and algae), part 1652. 4246. gbpln1653.seq - Plant sequence entries (including fungi and algae), part 1653. 4247. gbpln1654.seq - Plant sequence entries (including fungi and algae), part 1654. 4248. gbpln1655.seq - Plant sequence entries (including fungi and algae), part 1655. 4249. gbpln1656.seq - Plant sequence entries (including fungi and algae), part 1656. 4250. gbpln1657.seq - Plant sequence entries (including fungi and algae), part 1657. 4251. gbpln1658.seq - Plant sequence entries (including fungi and algae), part 1658. 4252. gbpln1659.seq - Plant sequence entries (including fungi and algae), part 1659. 4253. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166. 4254. gbpln1660.seq - Plant sequence entries (including fungi and algae), part 1660. 4255. gbpln1661.seq - Plant sequence entries (including fungi and algae), part 1661. 4256. gbpln1662.seq - Plant sequence entries (including fungi and algae), part 1662. 4257. gbpln1663.seq - Plant sequence entries (including fungi and algae), part 1663. 4258. gbpln1664.seq - Plant sequence entries (including fungi and algae), part 1664. 4259. gbpln1665.seq - Plant sequence entries (including fungi and algae), part 1665. 4260. gbpln1666.seq - Plant sequence entries (including fungi and algae), part 1666. 4261. gbpln1667.seq - Plant sequence entries (including fungi and algae), part 1667. 4262. gbpln1668.seq - Plant sequence entries (including fungi and algae), part 1668. 4263. gbpln1669.seq - Plant sequence entries (including fungi and algae), part 1669. 4264. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167. 4265. gbpln1670.seq - Plant sequence entries (including fungi and algae), part 1670. 4266. gbpln1671.seq - Plant sequence entries (including fungi and algae), part 1671. 4267. gbpln1672.seq - Plant sequence entries (including fungi and algae), part 1672. 4268. gbpln1673.seq - Plant sequence entries (including fungi and algae), part 1673. 4269. gbpln1674.seq - Plant sequence entries (including fungi and algae), part 1674. 4270. gbpln1675.seq - Plant sequence entries (including fungi and algae), part 1675. 4271. gbpln1676.seq - Plant sequence entries (including fungi and algae), part 1676. 4272. gbpln1677.seq - Plant sequence entries (including fungi and algae), part 1677. 4273. gbpln1678.seq - Plant sequence entries (including fungi and algae), part 1678. 4274. gbpln1679.seq - Plant sequence entries (including fungi and algae), part 1679. 4275. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168. 4276. gbpln1680.seq - Plant sequence entries (including fungi and algae), part 1680. 4277. gbpln1681.seq - Plant sequence entries (including fungi and algae), part 1681. 4278. gbpln1682.seq - Plant sequence entries (including fungi and algae), part 1682. 4279. gbpln1683.seq - Plant sequence entries (including fungi and algae), part 1683. 4280. gbpln1684.seq - Plant sequence entries (including fungi and algae), part 1684. 4281. gbpln1685.seq - Plant sequence entries (including fungi and algae), part 1685. 4282. gbpln1686.seq - Plant sequence entries (including fungi and algae), part 1686. 4283. gbpln1687.seq - Plant sequence entries (including fungi and algae), part 1687. 4284. gbpln1688.seq - Plant sequence entries (including fungi and algae), part 1688. 4285. gbpln1689.seq - Plant sequence entries (including fungi and algae), part 1689. 4286. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169. 4287. gbpln1690.seq - Plant sequence entries (including fungi and algae), part 1690. 4288. gbpln1691.seq - Plant sequence entries (including fungi and algae), part 1691. 4289. gbpln1692.seq - Plant sequence entries (including fungi and algae), part 1692. 4290. gbpln1693.seq - Plant sequence entries (including fungi and algae), part 1693. 4291. gbpln1694.seq - Plant sequence entries (including fungi and algae), part 1694. 4292. gbpln1695.seq - Plant sequence entries (including fungi and algae), part 1695. 4293. gbpln1696.seq - Plant sequence entries (including fungi and algae), part 1696. 4294. gbpln1697.seq - Plant sequence entries (including fungi and algae), part 1697. 4295. gbpln1698.seq - Plant sequence entries (including fungi and algae), part 1698. 4296. gbpln1699.seq - Plant sequence entries (including fungi and algae), part 1699. 4297. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17. 4298. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170. 4299. gbpln1700.seq - Plant sequence entries (including fungi and algae), part 1700. 4300. gbpln1701.seq - Plant sequence entries (including fungi and algae), part 1701. 4301. gbpln1702.seq - Plant sequence entries (including fungi and algae), part 1702. 4302. gbpln1703.seq - Plant sequence entries (including fungi and algae), part 1703. 4303. gbpln1704.seq - Plant sequence entries (including fungi and algae), part 1704. 4304. gbpln1705.seq - Plant sequence entries (including fungi and algae), part 1705. 4305. gbpln1706.seq - Plant sequence entries (including fungi and algae), part 1706. 4306. gbpln1707.seq - Plant sequence entries (including fungi and algae), part 1707. 4307. gbpln1708.seq - Plant sequence entries (including fungi and algae), part 1708. 4308. gbpln1709.seq - Plant sequence entries (including fungi and algae), part 1709. 4309. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171. 4310. gbpln1710.seq - Plant sequence entries (including fungi and algae), part 1710. 4311. gbpln1711.seq - Plant sequence entries (including fungi and algae), part 1711. 4312. gbpln1712.seq - Plant sequence entries (including fungi and algae), part 1712. 4313. gbpln1713.seq - Plant sequence entries (including fungi and algae), part 1713. 4314. gbpln1714.seq - Plant sequence entries (including fungi and algae), part 1714. 4315. gbpln1715.seq - Plant sequence entries (including fungi and algae), part 1715. 4316. gbpln1716.seq - Plant sequence entries (including fungi and algae), part 1716. 4317. gbpln1717.seq - Plant sequence entries (including fungi and algae), part 1717. 4318. gbpln1718.seq - Plant sequence entries (including fungi and algae), part 1718. 4319. gbpln1719.seq - Plant sequence entries (including fungi and algae), part 1719. 4320. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172. 4321. gbpln1720.seq - Plant sequence entries (including fungi and algae), part 1720. 4322. gbpln1721.seq - Plant sequence entries (including fungi and algae), part 1721. 4323. gbpln1722.seq - Plant sequence entries (including fungi and algae), part 1722. 4324. gbpln1723.seq - Plant sequence entries (including fungi and algae), part 1723. 4325. gbpln1724.seq - Plant sequence entries (including fungi and algae), part 1724. 4326. gbpln1725.seq - Plant sequence entries (including fungi and algae), part 1725. 4327. gbpln1726.seq - Plant sequence entries (including fungi and algae), part 1726. 4328. gbpln1727.seq - Plant sequence entries (including fungi and algae), part 1727. 4329. gbpln1728.seq - Plant sequence entries (including fungi and algae), part 1728. 4330. gbpln1729.seq - Plant sequence entries (including fungi and algae), part 1729. 4331. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173. 4332. gbpln1730.seq - Plant sequence entries (including fungi and algae), part 1730. 4333. gbpln1731.seq - Plant sequence entries (including fungi and algae), part 1731. 4334. gbpln1732.seq - Plant sequence entries (including fungi and algae), part 1732. 4335. gbpln1733.seq - Plant sequence entries (including fungi and algae), part 1733. 4336. gbpln1734.seq - Plant sequence entries (including fungi and algae), part 1734. 4337. gbpln1735.seq - Plant sequence entries (including fungi and algae), part 1735. 4338. gbpln1736.seq - Plant sequence entries (including fungi and algae), part 1736. 4339. gbpln1737.seq - Plant sequence entries (including fungi and algae), part 1737. 4340. gbpln1738.seq - Plant sequence entries (including fungi and algae), part 1738. 4341. gbpln1739.seq - Plant sequence entries (including fungi and algae), part 1739. 4342. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174. 4343. gbpln1740.seq - Plant sequence entries (including fungi and algae), part 1740. 4344. gbpln1741.seq - Plant sequence entries (including fungi and algae), part 1741. 4345. gbpln1742.seq - Plant sequence entries (including fungi and algae), part 1742. 4346. gbpln1743.seq - Plant sequence entries (including fungi and algae), part 1743. 4347. gbpln1744.seq - Plant sequence entries (including fungi and algae), part 1744. 4348. gbpln1745.seq - Plant sequence entries (including fungi and algae), part 1745. 4349. gbpln1746.seq - Plant sequence entries (including fungi and algae), part 1746. 4350. gbpln1747.seq - Plant sequence entries (including fungi and algae), part 1747. 4351. gbpln1748.seq - Plant sequence entries (including fungi and algae), part 1748. 4352. gbpln1749.seq - Plant sequence entries (including fungi and algae), part 1749. 4353. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175. 4354. gbpln1750.seq - Plant sequence entries (including fungi and algae), part 1750. 4355. gbpln1751.seq - Plant sequence entries (including fungi and algae), part 1751. 4356. gbpln1752.seq - Plant sequence entries (including fungi and algae), part 1752. 4357. gbpln1753.seq - Plant sequence entries (including fungi and algae), part 1753. 4358. gbpln1754.seq - Plant sequence entries (including fungi and algae), part 1754. 4359. gbpln1755.seq - Plant sequence entries (including fungi and algae), part 1755. 4360. gbpln1756.seq - Plant sequence entries (including fungi and algae), part 1756. 4361. gbpln1757.seq - Plant sequence entries (including fungi and algae), part 1757. 4362. gbpln1758.seq - Plant sequence entries (including fungi and algae), part 1758. 4363. gbpln1759.seq - Plant sequence entries (including fungi and algae), part 1759. 4364. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176. 4365. gbpln1760.seq - Plant sequence entries (including fungi and algae), part 1760. 4366. gbpln1761.seq - Plant sequence entries (including fungi and algae), part 1761. 4367. gbpln1762.seq - Plant sequence entries (including fungi and algae), part 1762. 4368. gbpln1763.seq - Plant sequence entries (including fungi and algae), part 1763. 4369. gbpln1764.seq - Plant sequence entries (including fungi and algae), part 1764. 4370. gbpln1765.seq - Plant sequence entries (including fungi and algae), part 1765. 4371. gbpln1766.seq - Plant sequence entries (including fungi and algae), part 1766. 4372. gbpln1767.seq - Plant sequence entries (including fungi and algae), part 1767. 4373. gbpln1768.seq - Plant sequence entries (including fungi and algae), part 1768. 4374. gbpln1769.seq - Plant sequence entries (including fungi and algae), part 1769. 4375. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177. 4376. gbpln1770.seq - Plant sequence entries (including fungi and algae), part 1770. 4377. gbpln1771.seq - Plant sequence entries (including fungi and algae), part 1771. 4378. gbpln1772.seq - Plant sequence entries (including fungi and algae), part 1772. 4379. gbpln1773.seq - Plant sequence entries (including fungi and algae), part 1773. 4380. gbpln1774.seq - Plant sequence entries (including fungi and algae), part 1774. 4381. gbpln1775.seq - Plant sequence entries (including fungi and algae), part 1775. 4382. gbpln1776.seq - Plant sequence entries (including fungi and algae), part 1776. 4383. gbpln1777.seq - Plant sequence entries (including fungi and algae), part 1777. 4384. gbpln1778.seq - Plant sequence entries (including fungi and algae), part 1778. 4385. gbpln1779.seq - Plant sequence entries (including fungi and algae), part 1779. 4386. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178. 4387. gbpln1780.seq - Plant sequence entries (including fungi and algae), part 1780. 4388. gbpln1781.seq - Plant sequence entries (including fungi and algae), part 1781. 4389. gbpln1782.seq - Plant sequence entries (including fungi and algae), part 1782. 4390. gbpln1783.seq - Plant sequence entries (including fungi and algae), part 1783. 4391. gbpln1784.seq - Plant sequence entries (including fungi and algae), part 1784. 4392. gbpln1785.seq - Plant sequence entries (including fungi and algae), part 1785. 4393. gbpln1786.seq - Plant sequence entries (including fungi and algae), part 1786. 4394. gbpln1787.seq - Plant sequence entries (including fungi and algae), part 1787. 4395. gbpln1788.seq - Plant sequence entries (including fungi and algae), part 1788. 4396. gbpln1789.seq - Plant sequence entries (including fungi and algae), part 1789. 4397. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179. 4398. gbpln1790.seq - Plant sequence entries (including fungi and algae), part 1790. 4399. gbpln1791.seq - Plant sequence entries (including fungi and algae), part 1791. 4400. gbpln1792.seq - Plant sequence entries (including fungi and algae), part 1792. 4401. gbpln1793.seq - Plant sequence entries (including fungi and algae), part 1793. 4402. gbpln1794.seq - Plant sequence entries (including fungi and algae), part 1794. 4403. gbpln1795.seq - Plant sequence entries (including fungi and algae), part 1795. 4404. gbpln1796.seq - Plant sequence entries (including fungi and algae), part 1796. 4405. gbpln1797.seq - Plant sequence entries (including fungi and algae), part 1797. 4406. gbpln1798.seq - Plant sequence entries (including fungi and algae), part 1798. 4407. gbpln1799.seq - Plant sequence entries (including fungi and algae), part 1799. 4408. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18. 4409. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180. 4410. gbpln1800.seq - Plant sequence entries (including fungi and algae), part 1800. 4411. gbpln1801.seq - Plant sequence entries (including fungi and algae), part 1801. 4412. gbpln1802.seq - Plant sequence entries (including fungi and algae), part 1802. 4413. gbpln1803.seq - Plant sequence entries (including fungi and algae), part 1803. 4414. gbpln1804.seq - Plant sequence entries (including fungi and algae), part 1804. 4415. gbpln1805.seq - Plant sequence entries (including fungi and algae), part 1805. 4416. gbpln1806.seq - Plant sequence entries (including fungi and algae), part 1806. 4417. gbpln1807.seq - Plant sequence entries (including fungi and algae), part 1807. 4418. gbpln1808.seq - Plant sequence entries (including fungi and algae), part 1808. 4419. gbpln1809.seq - Plant sequence entries (including fungi and algae), part 1809. 4420. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181. 4421. gbpln1810.seq - Plant sequence entries (including fungi and algae), part 1810. 4422. gbpln1811.seq - Plant sequence entries (including fungi and algae), part 1811. 4423. gbpln1812.seq - Plant sequence entries (including fungi and algae), part 1812. 4424. gbpln1813.seq - Plant sequence entries (including fungi and algae), part 1813. 4425. gbpln1814.seq - Plant sequence entries (including fungi and algae), part 1814. 4426. gbpln1815.seq - Plant sequence entries (including fungi and algae), part 1815. 4427. gbpln1816.seq - Plant sequence entries (including fungi and algae), part 1816. 4428. gbpln1817.seq - Plant sequence entries (including fungi and algae), part 1817. 4429. gbpln1818.seq - Plant sequence entries (including fungi and algae), part 1818. 4430. gbpln1819.seq - Plant sequence entries (including fungi and algae), part 1819. 4431. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182. 4432. gbpln1820.seq - Plant sequence entries (including fungi and algae), part 1820. 4433. gbpln1821.seq - Plant sequence entries (including fungi and algae), part 1821. 4434. gbpln1822.seq - Plant sequence entries (including fungi and algae), part 1822. 4435. gbpln1823.seq - Plant sequence entries (including fungi and algae), part 1823. 4436. gbpln1824.seq - Plant sequence entries (including fungi and algae), part 1824. 4437. gbpln1825.seq - Plant sequence entries (including fungi and algae), part 1825. 4438. gbpln1826.seq - Plant sequence entries (including fungi and algae), part 1826. 4439. gbpln1827.seq - Plant sequence entries (including fungi and algae), part 1827. 4440. gbpln1828.seq - Plant sequence entries (including fungi and algae), part 1828. 4441. gbpln1829.seq - Plant sequence entries (including fungi and algae), part 1829. 4442. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183. 4443. gbpln1830.seq - Plant sequence entries (including fungi and algae), part 1830. 4444. gbpln1831.seq - Plant sequence entries (including fungi and algae), part 1831. 4445. gbpln1832.seq - Plant sequence entries (including fungi and algae), part 1832. 4446. gbpln1833.seq - Plant sequence entries (including fungi and algae), part 1833. 4447. gbpln1834.seq - Plant sequence entries (including fungi and algae), part 1834. 4448. gbpln1835.seq - Plant sequence entries (including fungi and algae), part 1835. 4449. gbpln1836.seq - Plant sequence entries (including fungi and algae), part 1836. 4450. gbpln1837.seq - Plant sequence entries (including fungi and algae), part 1837. 4451. gbpln1838.seq - Plant sequence entries (including fungi and algae), part 1838. 4452. gbpln1839.seq - Plant sequence entries (including fungi and algae), part 1839. 4453. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184. 4454. gbpln1840.seq - Plant sequence entries (including fungi and algae), part 1840. 4455. gbpln1841.seq - Plant sequence entries (including fungi and algae), part 1841. 4456. gbpln1842.seq - Plant sequence entries (including fungi and algae), part 1842. 4457. gbpln1843.seq - Plant sequence entries (including fungi and algae), part 1843. 4458. gbpln1844.seq - Plant sequence entries (including fungi and algae), part 1844. 4459. gbpln1845.seq - Plant sequence entries (including fungi and algae), part 1845. 4460. gbpln1846.seq - Plant sequence entries (including fungi and algae), part 1846. 4461. gbpln1847.seq - Plant sequence entries (including fungi and algae), part 1847. 4462. gbpln1848.seq - Plant sequence entries (including fungi and algae), part 1848. 4463. gbpln1849.seq - Plant sequence entries (including fungi and algae), part 1849. 4464. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185. 4465. gbpln1850.seq - Plant sequence entries (including fungi and algae), part 1850. 4466. gbpln1851.seq - Plant sequence entries (including fungi and algae), part 1851. 4467. gbpln1852.seq - Plant sequence entries (including fungi and algae), part 1852. 4468. gbpln1853.seq - Plant sequence entries (including fungi and algae), part 1853. 4469. gbpln1854.seq - Plant sequence entries (including fungi and algae), part 1854. 4470. gbpln1855.seq - Plant sequence entries (including fungi and algae), part 1855. 4471. gbpln1856.seq - Plant sequence entries (including fungi and algae), part 1856. 4472. gbpln1857.seq - Plant sequence entries (including fungi and algae), part 1857. 4473. gbpln1858.seq - Plant sequence entries (including fungi and algae), part 1858. 4474. gbpln1859.seq - Plant sequence entries (including fungi and algae), part 1859. 4475. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186. 4476. gbpln1860.seq - Plant sequence entries (including fungi and algae), part 1860. 4477. gbpln1861.seq - Plant sequence entries (including fungi and algae), part 1861. 4478. gbpln1862.seq - Plant sequence entries (including fungi and algae), part 1862. 4479. gbpln1863.seq - Plant sequence entries (including fungi and algae), part 1863. 4480. gbpln1864.seq - Plant sequence entries (including fungi and algae), part 1864. 4481. gbpln1865.seq - Plant sequence entries (including fungi and algae), part 1865. 4482. gbpln1866.seq - Plant sequence entries (including fungi and algae), part 1866. 4483. gbpln1867.seq - Plant sequence entries (including fungi and algae), part 1867. 4484. gbpln1868.seq - Plant sequence entries (including fungi and algae), part 1868. 4485. gbpln1869.seq - Plant sequence entries (including fungi and algae), part 1869. 4486. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187. 4487. gbpln1870.seq - Plant sequence entries (including fungi and algae), part 1870. 4488. gbpln1871.seq - Plant sequence entries (including fungi and algae), part 1871. 4489. gbpln1872.seq - Plant sequence entries (including fungi and algae), part 1872. 4490. gbpln1873.seq - Plant sequence entries (including fungi and algae), part 1873. 4491. gbpln1874.seq - Plant sequence entries (including fungi and algae), part 1874. 4492. gbpln1875.seq - Plant sequence entries (including fungi and algae), part 1875. 4493. gbpln1876.seq - Plant sequence entries (including fungi and algae), part 1876. 4494. gbpln1877.seq - Plant sequence entries (including fungi and algae), part 1877. 4495. gbpln1878.seq - Plant sequence entries (including fungi and algae), part 1878. 4496. gbpln1879.seq - Plant sequence entries (including fungi and algae), part 1879. 4497. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188. 4498. gbpln1880.seq - Plant sequence entries (including fungi and algae), part 1880. 4499. gbpln1881.seq - Plant sequence entries (including fungi and algae), part 1881. 4500. gbpln1882.seq - Plant sequence entries (including fungi and algae), part 1882. 4501. gbpln1883.seq - Plant sequence entries (including fungi and algae), part 1883. 4502. gbpln1884.seq - Plant sequence entries (including fungi and algae), part 1884. 4503. gbpln1885.seq - Plant sequence entries (including fungi and algae), part 1885. 4504. gbpln1886.seq - Plant sequence entries (including fungi and algae), part 1886. 4505. gbpln1887.seq - Plant sequence entries (including fungi and algae), part 1887. 4506. gbpln1888.seq - Plant sequence entries (including fungi and algae), part 1888. 4507. gbpln1889.seq - Plant sequence entries (including fungi and algae), part 1889. 4508. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189. 4509. gbpln1890.seq - Plant sequence entries (including fungi and algae), part 1890. 4510. gbpln1891.seq - Plant sequence entries (including fungi and algae), part 1891. 4511. gbpln1892.seq - Plant sequence entries (including fungi and algae), part 1892. 4512. gbpln1893.seq - Plant sequence entries (including fungi and algae), part 1893. 4513. gbpln1894.seq - Plant sequence entries (including fungi and algae), part 1894. 4514. gbpln1895.seq - Plant sequence entries (including fungi and algae), part 1895. 4515. gbpln1896.seq - Plant sequence entries (including fungi and algae), part 1896. 4516. gbpln1897.seq - Plant sequence entries (including fungi and algae), part 1897. 4517. gbpln1898.seq - Plant sequence entries (including fungi and algae), part 1898. 4518. gbpln1899.seq - Plant sequence entries (including fungi and algae), part 1899. 4519. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19. 4520. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190. 4521. gbpln1900.seq - Plant sequence entries (including fungi and algae), part 1900. 4522. gbpln1901.seq - Plant sequence entries (including fungi and algae), part 1901. 4523. gbpln1902.seq - Plant sequence entries (including fungi and algae), part 1902. 4524. gbpln1903.seq - Plant sequence entries (including fungi and algae), part 1903. 4525. gbpln1904.seq - Plant sequence entries (including fungi and algae), part 1904. 4526. gbpln1905.seq - Plant sequence entries (including fungi and algae), part 1905. 4527. gbpln1906.seq - Plant sequence entries (including fungi and algae), part 1906. 4528. gbpln1907.seq - Plant sequence entries (including fungi and algae), part 1907. 4529. gbpln1908.seq - Plant sequence entries (including fungi and algae), part 1908. 4530. gbpln1909.seq - Plant sequence entries (including fungi and algae), part 1909. 4531. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191. 4532. gbpln1910.seq - Plant sequence entries (including fungi and algae), part 1910. 4533. gbpln1911.seq - Plant sequence entries (including fungi and algae), part 1911. 4534. gbpln1912.seq - Plant sequence entries (including fungi and algae), part 1912. 4535. gbpln1913.seq - Plant sequence entries (including fungi and algae), part 1913. 4536. gbpln1914.seq - Plant sequence entries (including fungi and algae), part 1914. 4537. gbpln1915.seq - Plant sequence entries (including fungi and algae), part 1915. 4538. gbpln1916.seq - Plant sequence entries (including fungi and algae), part 1916. 4539. gbpln1917.seq - Plant sequence entries (including fungi and algae), part 1917. 4540. gbpln1918.seq - Plant sequence entries (including fungi and algae), part 1918. 4541. gbpln1919.seq - Plant sequence entries (including fungi and algae), part 1919. 4542. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192. 4543. gbpln1920.seq - Plant sequence entries (including fungi and algae), part 1920. 4544. gbpln1921.seq - Plant sequence entries (including fungi and algae), part 1921. 4545. gbpln1922.seq - Plant sequence entries (including fungi and algae), part 1922. 4546. gbpln1923.seq - Plant sequence entries (including fungi and algae), part 1923. 4547. gbpln1924.seq - Plant sequence entries (including fungi and algae), part 1924. 4548. gbpln1925.seq - Plant sequence entries (including fungi and algae), part 1925. 4549. gbpln1926.seq - Plant sequence entries (including fungi and algae), part 1926. 4550. gbpln1927.seq - Plant sequence entries (including fungi and algae), part 1927. 4551. gbpln1928.seq - Plant sequence entries (including fungi and algae), part 1928. 4552. gbpln1929.seq - Plant sequence entries (including fungi and algae), part 1929. 4553. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193. 4554. gbpln1930.seq - Plant sequence entries (including fungi and algae), part 1930. 4555. gbpln1931.seq - Plant sequence entries (including fungi and algae), part 1931. 4556. gbpln1932.seq - Plant sequence entries (including fungi and algae), part 1932. 4557. gbpln1933.seq - Plant sequence entries (including fungi and algae), part 1933. 4558. gbpln1934.seq - Plant sequence entries (including fungi and algae), part 1934. 4559. gbpln1935.seq - Plant sequence entries (including fungi and algae), part 1935. 4560. gbpln1936.seq - Plant sequence entries (including fungi and algae), part 1936. 4561. gbpln1937.seq - Plant sequence entries (including fungi and algae), part 1937. 4562. gbpln1938.seq - Plant sequence entries (including fungi and algae), part 1938. 4563. gbpln1939.seq - Plant sequence entries (including fungi and algae), part 1939. 4564. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194. 4565. gbpln1940.seq - Plant sequence entries (including fungi and algae), part 1940. 4566. gbpln1941.seq - Plant sequence entries (including fungi and algae), part 1941. 4567. gbpln1942.seq - Plant sequence entries (including fungi and algae), part 1942. 4568. gbpln1943.seq - Plant sequence entries (including fungi and algae), part 1943. 4569. gbpln1944.seq - Plant sequence entries (including fungi and algae), part 1944. 4570. gbpln1945.seq - Plant sequence entries (including fungi and algae), part 1945. 4571. gbpln1946.seq - Plant sequence entries (including fungi and algae), part 1946. 4572. gbpln1947.seq - Plant sequence entries (including fungi and algae), part 1947. 4573. gbpln1948.seq - Plant sequence entries (including fungi and algae), part 1948. 4574. gbpln1949.seq - Plant sequence entries (including fungi and algae), part 1949. 4575. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195. 4576. gbpln1950.seq - Plant sequence entries (including fungi and algae), part 1950. 4577. gbpln1951.seq - Plant sequence entries (including fungi and algae), part 1951. 4578. gbpln1952.seq - Plant sequence entries (including fungi and algae), part 1952. 4579. gbpln1953.seq - Plant sequence entries (including fungi and algae), part 1953. 4580. gbpln1954.seq - Plant sequence entries (including fungi and algae), part 1954. 4581. gbpln1955.seq - Plant sequence entries (including fungi and algae), part 1955. 4582. gbpln1956.seq - Plant sequence entries (including fungi and algae), part 1956. 4583. gbpln1957.seq - Plant sequence entries (including fungi and algae), part 1957. 4584. gbpln1958.seq - Plant sequence entries (including fungi and algae), part 1958. 4585. gbpln1959.seq - Plant sequence entries (including fungi and algae), part 1959. 4586. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196. 4587. gbpln1960.seq - Plant sequence entries (including fungi and algae), part 1960. 4588. gbpln1961.seq - Plant sequence entries (including fungi and algae), part 1961. 4589. gbpln1962.seq - Plant sequence entries (including fungi and algae), part 1962. 4590. gbpln1963.seq - Plant sequence entries (including fungi and algae), part 1963. 4591. gbpln1964.seq - Plant sequence entries (including fungi and algae), part 1964. 4592. gbpln1965.seq - Plant sequence entries (including fungi and algae), part 1965. 4593. gbpln1966.seq - Plant sequence entries (including fungi and algae), part 1966. 4594. gbpln1967.seq - Plant sequence entries (including fungi and algae), part 1967. 4595. gbpln1968.seq - Plant sequence entries (including fungi and algae), part 1968. 4596. gbpln1969.seq - Plant sequence entries (including fungi and algae), part 1969. 4597. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197. 4598. gbpln1970.seq - Plant sequence entries (including fungi and algae), part 1970. 4599. gbpln1971.seq - Plant sequence entries (including fungi and algae), part 1971. 4600. gbpln1972.seq - Plant sequence entries (including fungi and algae), part 1972. 4601. gbpln1973.seq - Plant sequence entries (including fungi and algae), part 1973. 4602. gbpln1974.seq - Plant sequence entries (including fungi and algae), part 1974. 4603. gbpln1975.seq - Plant sequence entries (including fungi and algae), part 1975. 4604. gbpln1976.seq - Plant sequence entries (including fungi and algae), part 1976. 4605. gbpln1977.seq - Plant sequence entries (including fungi and algae), part 1977. 4606. gbpln1978.seq - Plant sequence entries (including fungi and algae), part 1978. 4607. gbpln1979.seq - Plant sequence entries (including fungi and algae), part 1979. 4608. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198. 4609. gbpln1980.seq - Plant sequence entries (including fungi and algae), part 1980. 4610. gbpln1981.seq - Plant sequence entries (including fungi and algae), part 1981. 4611. gbpln1982.seq - Plant sequence entries (including fungi and algae), part 1982. 4612. gbpln1983.seq - Plant sequence entries (including fungi and algae), part 1983. 4613. gbpln1984.seq - Plant sequence entries (including fungi and algae), part 1984. 4614. gbpln1985.seq - Plant sequence entries (including fungi and algae), part 1985. 4615. gbpln1986.seq - Plant sequence entries (including fungi and algae), part 1986. 4616. gbpln1987.seq - Plant sequence entries (including fungi and algae), part 1987. 4617. gbpln1988.seq - Plant sequence entries (including fungi and algae), part 1988. 4618. gbpln1989.seq - Plant sequence entries (including fungi and algae), part 1989. 4619. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199. 4620. gbpln1990.seq - Plant sequence entries (including fungi and algae), part 1990. 4621. gbpln1991.seq - Plant sequence entries (including fungi and algae), part 1991. 4622. gbpln1992.seq - Plant sequence entries (including fungi and algae), part 1992. 4623. gbpln1993.seq - Plant sequence entries (including fungi and algae), part 1993. 4624. gbpln1994.seq - Plant sequence entries (including fungi and algae), part 1994. 4625. gbpln1995.seq - Plant sequence entries (including fungi and algae), part 1995. 4626. gbpln1996.seq - Plant sequence entries (including fungi and algae), part 1996. 4627. gbpln1997.seq - Plant sequence entries (including fungi and algae), part 1997. 4628. gbpln1998.seq - Plant sequence entries (including fungi and algae), part 1998. 4629. gbpln1999.seq - Plant sequence entries (including fungi and algae), part 1999. 4630. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2. 4631. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20. 4632. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200. 4633. gbpln2000.seq - Plant sequence entries (including fungi and algae), part 2000. 4634. gbpln2001.seq - Plant sequence entries (including fungi and algae), part 2001. 4635. gbpln2002.seq - Plant sequence entries (including fungi and algae), part 2002. 4636. gbpln2003.seq - Plant sequence entries (including fungi and algae), part 2003. 4637. gbpln2004.seq - Plant sequence entries (including fungi and algae), part 2004. 4638. gbpln2005.seq - Plant sequence entries (including fungi and algae), part 2005. 4639. gbpln2006.seq - Plant sequence entries (including fungi and algae), part 2006. 4640. gbpln2007.seq - Plant sequence entries (including fungi and algae), part 2007. 4641. gbpln2008.seq - Plant sequence entries (including fungi and algae), part 2008. 4642. gbpln2009.seq - Plant sequence entries (including fungi and algae), part 2009. 4643. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201. 4644. gbpln2010.seq - Plant sequence entries (including fungi and algae), part 2010. 4645. gbpln2011.seq - Plant sequence entries (including fungi and algae), part 2011. 4646. gbpln2012.seq - Plant sequence entries (including fungi and algae), part 2012. 4647. gbpln2013.seq - Plant sequence entries (including fungi and algae), part 2013. 4648. gbpln2014.seq - Plant sequence entries (including fungi and algae), part 2014. 4649. gbpln2015.seq - Plant sequence entries (including fungi and algae), part 2015. 4650. gbpln2016.seq - Plant sequence entries (including fungi and algae), part 2016. 4651. gbpln2017.seq - Plant sequence entries (including fungi and algae), part 2017. 4652. gbpln2018.seq - Plant sequence entries (including fungi and algae), part 2018. 4653. gbpln2019.seq - Plant sequence entries (including fungi and algae), part 2019. 4654. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202. 4655. gbpln2020.seq - Plant sequence entries (including fungi and algae), part 2020. 4656. gbpln2021.seq - Plant sequence entries (including fungi and algae), part 2021. 4657. gbpln2022.seq - Plant sequence entries (including fungi and algae), part 2022. 4658. gbpln2023.seq - Plant sequence entries (including fungi and algae), part 2023. 4659. gbpln2024.seq - Plant sequence entries (including fungi and algae), part 2024. 4660. gbpln2025.seq - Plant sequence entries (including fungi and algae), part 2025. 4661. gbpln2026.seq - Plant sequence entries (including fungi and algae), part 2026. 4662. gbpln2027.seq - Plant sequence entries (including fungi and algae), part 2027. 4663. gbpln2028.seq - Plant sequence entries (including fungi and algae), part 2028. 4664. gbpln2029.seq - Plant sequence entries (including fungi and algae), part 2029. 4665. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203. 4666. gbpln2030.seq - Plant sequence entries (including fungi and algae), part 2030. 4667. gbpln2031.seq - Plant sequence entries (including fungi and algae), part 2031. 4668. gbpln2032.seq - Plant sequence entries (including fungi and algae), part 2032. 4669. gbpln2033.seq - Plant sequence entries (including fungi and algae), part 2033. 4670. gbpln2034.seq - Plant sequence entries (including fungi and algae), part 2034. 4671. gbpln2035.seq - Plant sequence entries (including fungi and algae), part 2035. 4672. gbpln2036.seq - Plant sequence entries (including fungi and algae), part 2036. 4673. gbpln2037.seq - Plant sequence entries (including fungi and algae), part 2037. 4674. gbpln2038.seq - Plant sequence entries (including fungi and algae), part 2038. 4675. gbpln2039.seq - Plant sequence entries (including fungi and algae), part 2039. 4676. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204. 4677. gbpln2040.seq - Plant sequence entries (including fungi and algae), part 2040. 4678. gbpln2041.seq - Plant sequence entries (including fungi and algae), part 2041. 4679. gbpln2042.seq - Plant sequence entries (including fungi and algae), part 2042. 4680. gbpln2043.seq - Plant sequence entries (including fungi and algae), part 2043. 4681. gbpln2044.seq - Plant sequence entries (including fungi and algae), part 2044. 4682. gbpln2045.seq - Plant sequence entries (including fungi and algae), part 2045. 4683. gbpln2046.seq - Plant sequence entries (including fungi and algae), part 2046. 4684. gbpln2047.seq - Plant sequence entries (including fungi and algae), part 2047. 4685. gbpln2048.seq - Plant sequence entries (including fungi and algae), part 2048. 4686. gbpln2049.seq - Plant sequence entries (including fungi and algae), part 2049. 4687. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205. 4688. gbpln2050.seq - Plant sequence entries (including fungi and algae), part 2050. 4689. gbpln2051.seq - Plant sequence entries (including fungi and algae), part 2051. 4690. gbpln2052.seq - Plant sequence entries (including fungi and algae), part 2052. 4691. gbpln2053.seq - Plant sequence entries (including fungi and algae), part 2053. 4692. gbpln2054.seq - Plant sequence entries (including fungi and algae), part 2054. 4693. gbpln2055.seq - Plant sequence entries (including fungi and algae), part 2055. 4694. gbpln2056.seq - Plant sequence entries (including fungi and algae), part 2056. 4695. gbpln2057.seq - Plant sequence entries (including fungi and algae), part 2057. 4696. gbpln2058.seq - Plant sequence entries (including fungi and algae), part 2058. 4697. gbpln2059.seq - Plant sequence entries (including fungi and algae), part 2059. 4698. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206. 4699. gbpln2060.seq - Plant sequence entries (including fungi and algae), part 2060. 4700. gbpln2061.seq - Plant sequence entries (including fungi and algae), part 2061. 4701. gbpln2062.seq - Plant sequence entries (including fungi and algae), part 2062. 4702. gbpln2063.seq - Plant sequence entries (including fungi and algae), part 2063. 4703. gbpln2064.seq - Plant sequence entries (including fungi and algae), part 2064. 4704. gbpln2065.seq - Plant sequence entries (including fungi and algae), part 2065. 4705. gbpln2066.seq - Plant sequence entries (including fungi and algae), part 2066. 4706. gbpln2067.seq - Plant sequence entries (including fungi and algae), part 2067. 4707. gbpln2068.seq - Plant sequence entries (including fungi and algae), part 2068. 4708. gbpln2069.seq - Plant sequence entries (including fungi and algae), part 2069. 4709. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207. 4710. gbpln2070.seq - Plant sequence entries (including fungi and algae), part 2070. 4711. gbpln2071.seq - Plant sequence entries (including fungi and algae), part 2071. 4712. gbpln2072.seq - Plant sequence entries (including fungi and algae), part 2072. 4713. gbpln2073.seq - Plant sequence entries (including fungi and algae), part 2073. 4714. gbpln2074.seq - Plant sequence entries (including fungi and algae), part 2074. 4715. gbpln2075.seq - Plant sequence entries (including fungi and algae), part 2075. 4716. gbpln2076.seq - Plant sequence entries (including fungi and algae), part 2076. 4717. gbpln2077.seq - Plant sequence entries (including fungi and algae), part 2077. 4718. gbpln2078.seq - Plant sequence entries (including fungi and algae), part 2078. 4719. gbpln2079.seq - Plant sequence entries (including fungi and algae), part 2079. 4720. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208. 4721. gbpln2080.seq - Plant sequence entries (including fungi and algae), part 2080. 4722. gbpln2081.seq - Plant sequence entries (including fungi and algae), part 2081. 4723. gbpln2082.seq - Plant sequence entries (including fungi and algae), part 2082. 4724. gbpln2083.seq - Plant sequence entries (including fungi and algae), part 2083. 4725. gbpln2084.seq - Plant sequence entries (including fungi and algae), part 2084. 4726. gbpln2085.seq - Plant sequence entries (including fungi and algae), part 2085. 4727. gbpln2086.seq - Plant sequence entries (including fungi and algae), part 2086. 4728. gbpln2087.seq - Plant sequence entries (including fungi and algae), part 2087. 4729. gbpln2088.seq - Plant sequence entries (including fungi and algae), part 2088. 4730. gbpln2089.seq - Plant sequence entries (including fungi and algae), part 2089. 4731. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209. 4732. gbpln2090.seq - Plant sequence entries (including fungi and algae), part 2090. 4733. gbpln2091.seq - Plant sequence entries (including fungi and algae), part 2091. 4734. gbpln2092.seq - Plant sequence entries (including fungi and algae), part 2092. 4735. gbpln2093.seq - Plant sequence entries (including fungi and algae), part 2093. 4736. gbpln2094.seq - Plant sequence entries (including fungi and algae), part 2094. 4737. gbpln2095.seq - Plant sequence entries (including fungi and algae), part 2095. 4738. gbpln2096.seq - Plant sequence entries (including fungi and algae), part 2096. 4739. gbpln2097.seq - Plant sequence entries (including fungi and algae), part 2097. 4740. gbpln2098.seq - Plant sequence entries (including fungi and algae), part 2098. 4741. gbpln2099.seq - Plant sequence entries (including fungi and algae), part 2099. 4742. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21. 4743. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210. 4744. gbpln2100.seq - Plant sequence entries (including fungi and algae), part 2100. 4745. gbpln2101.seq - Plant sequence entries (including fungi and algae), part 2101. 4746. gbpln2102.seq - Plant sequence entries (including fungi and algae), part 2102. 4747. gbpln2103.seq - Plant sequence entries (including fungi and algae), part 2103. 4748. gbpln2104.seq - Plant sequence entries (including fungi and algae), part 2104. 4749. gbpln2105.seq - Plant sequence entries (including fungi and algae), part 2105. 4750. gbpln2106.seq - Plant sequence entries (including fungi and algae), part 2106. 4751. gbpln2107.seq - Plant sequence entries (including fungi and algae), part 2107. 4752. gbpln2108.seq - Plant sequence entries (including fungi and algae), part 2108. 4753. gbpln2109.seq - Plant sequence entries (including fungi and algae), part 2109. 4754. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211. 4755. gbpln2110.seq - Plant sequence entries (including fungi and algae), part 2110. 4756. gbpln2111.seq - Plant sequence entries (including fungi and algae), part 2111. 4757. gbpln2112.seq - Plant sequence entries (including fungi and algae), part 2112. 4758. gbpln2113.seq - Plant sequence entries (including fungi and algae), part 2113. 4759. gbpln2114.seq - Plant sequence entries (including fungi and algae), part 2114. 4760. gbpln2115.seq - Plant sequence entries (including fungi and algae), part 2115. 4761. gbpln2116.seq - Plant sequence entries (including fungi and algae), part 2116. 4762. gbpln2117.seq - Plant sequence entries (including fungi and algae), part 2117. 4763. gbpln2118.seq - Plant sequence entries (including fungi and algae), part 2118. 4764. gbpln2119.seq - Plant sequence entries (including fungi and algae), part 2119. 4765. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212. 4766. gbpln2120.seq - Plant sequence entries (including fungi and algae), part 2120. 4767. gbpln2121.seq - Plant sequence entries (including fungi and algae), part 2121. 4768. gbpln2122.seq - Plant sequence entries (including fungi and algae), part 2122. 4769. gbpln2123.seq - Plant sequence entries (including fungi and algae), part 2123. 4770. gbpln2124.seq - Plant sequence entries (including fungi and algae), part 2124. 4771. gbpln2125.seq - Plant sequence entries (including fungi and algae), part 2125. 4772. gbpln2126.seq - Plant sequence entries (including fungi and algae), part 2126. 4773. gbpln2127.seq - Plant sequence entries (including fungi and algae), part 2127. 4774. gbpln2128.seq - Plant sequence entries (including fungi and algae), part 2128. 4775. gbpln2129.seq - Plant sequence entries (including fungi and algae), part 2129. 4776. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213. 4777. gbpln2130.seq - Plant sequence entries (including fungi and algae), part 2130. 4778. gbpln2131.seq - Plant sequence entries (including fungi and algae), part 2131. 4779. gbpln2132.seq - Plant sequence entries (including fungi and algae), part 2132. 4780. gbpln2133.seq - Plant sequence entries (including fungi and algae), part 2133. 4781. gbpln2134.seq - Plant sequence entries (including fungi and algae), part 2134. 4782. gbpln2135.seq - Plant sequence entries (including fungi and algae), part 2135. 4783. gbpln2136.seq - Plant sequence entries (including fungi and algae), part 2136. 4784. gbpln2137.seq - Plant sequence entries (including fungi and algae), part 2137. 4785. gbpln2138.seq - Plant sequence entries (including fungi and algae), part 2138. 4786. gbpln2139.seq - Plant sequence entries (including fungi and algae), part 2139. 4787. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214. 4788. gbpln2140.seq - Plant sequence entries (including fungi and algae), part 2140. 4789. gbpln2141.seq - Plant sequence entries (including fungi and algae), part 2141. 4790. gbpln2142.seq - Plant sequence entries (including fungi and algae), part 2142. 4791. gbpln2143.seq - Plant sequence entries (including fungi and algae), part 2143. 4792. gbpln2144.seq - Plant sequence entries (including fungi and algae), part 2144. 4793. gbpln2145.seq - Plant sequence entries (including fungi and algae), part 2145. 4794. gbpln2146.seq - Plant sequence entries (including fungi and algae), part 2146. 4795. gbpln2147.seq - Plant sequence entries (including fungi and algae), part 2147. 4796. gbpln2148.seq - Plant sequence entries (including fungi and algae), part 2148. 4797. gbpln2149.seq - Plant sequence entries (including fungi and algae), part 2149. 4798. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215. 4799. gbpln2150.seq - Plant sequence entries (including fungi and algae), part 2150. 4800. gbpln2151.seq - Plant sequence entries (including fungi and algae), part 2151. 4801. gbpln2152.seq - Plant sequence entries (including fungi and algae), part 2152. 4802. gbpln2153.seq - Plant sequence entries (including fungi and algae), part 2153. 4803. gbpln2154.seq - Plant sequence entries (including fungi and algae), part 2154. 4804. gbpln2155.seq - Plant sequence entries (including fungi and algae), part 2155. 4805. gbpln2156.seq - Plant sequence entries (including fungi and algae), part 2156. 4806. gbpln2157.seq - Plant sequence entries (including fungi and algae), part 2157. 4807. gbpln2158.seq - Plant sequence entries (including fungi and algae), part 2158. 4808. gbpln2159.seq - Plant sequence entries (including fungi and algae), part 2159. 4809. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216. 4810. gbpln2160.seq - Plant sequence entries (including fungi and algae), part 2160. 4811. gbpln2161.seq - Plant sequence entries (including fungi and algae), part 2161. 4812. gbpln2162.seq - Plant sequence entries (including fungi and algae), part 2162. 4813. gbpln2163.seq - Plant sequence entries (including fungi and algae), part 2163. 4814. gbpln2164.seq - Plant sequence entries (including fungi and algae), part 2164. 4815. gbpln2165.seq - Plant sequence entries (including fungi and algae), part 2165. 4816. gbpln2166.seq - Plant sequence entries (including fungi and algae), part 2166. 4817. gbpln2167.seq - Plant sequence entries (including fungi and algae), part 2167. 4818. gbpln2168.seq - Plant sequence entries (including fungi and algae), part 2168. 4819. gbpln2169.seq - Plant sequence entries (including fungi and algae), part 2169. 4820. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217. 4821. gbpln2170.seq - Plant sequence entries (including fungi and algae), part 2170. 4822. gbpln2171.seq - Plant sequence entries (including fungi and algae), part 2171. 4823. gbpln2172.seq - Plant sequence entries (including fungi and algae), part 2172. 4824. gbpln2173.seq - Plant sequence entries (including fungi and algae), part 2173. 4825. gbpln2174.seq - Plant sequence entries (including fungi and algae), part 2174. 4826. gbpln2175.seq - Plant sequence entries (including fungi and algae), part 2175. 4827. gbpln2176.seq - Plant sequence entries (including fungi and algae), part 2176. 4828. gbpln2177.seq - Plant sequence entries (including fungi and algae), part 2177. 4829. gbpln2178.seq - Plant sequence entries (including fungi and algae), part 2178. 4830. gbpln2179.seq - Plant sequence entries (including fungi and algae), part 2179. 4831. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218. 4832. gbpln2180.seq - Plant sequence entries (including fungi and algae), part 2180. 4833. gbpln2181.seq - Plant sequence entries (including fungi and algae), part 2181. 4834. gbpln2182.seq - Plant sequence entries (including fungi and algae), part 2182. 4835. gbpln2183.seq - Plant sequence entries (including fungi and algae), part 2183. 4836. gbpln2184.seq - Plant sequence entries (including fungi and algae), part 2184. 4837. gbpln2185.seq - Plant sequence entries (including fungi and algae), part 2185. 4838. gbpln2186.seq - Plant sequence entries (including fungi and algae), part 2186. 4839. gbpln2187.seq - Plant sequence entries (including fungi and algae), part 2187. 4840. gbpln2188.seq - Plant sequence entries (including fungi and algae), part 2188. 4841. gbpln2189.seq - Plant sequence entries (including fungi and algae), part 2189. 4842. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219. 4843. gbpln2190.seq - Plant sequence entries (including fungi and algae), part 2190. 4844. gbpln2191.seq - Plant sequence entries (including fungi and algae), part 2191. 4845. gbpln2192.seq - Plant sequence entries (including fungi and algae), part 2192. 4846. gbpln2193.seq - Plant sequence entries (including fungi and algae), part 2193. 4847. gbpln2194.seq - Plant sequence entries (including fungi and algae), part 2194. 4848. gbpln2195.seq - Plant sequence entries (including fungi and algae), part 2195. 4849. gbpln2196.seq - Plant sequence entries (including fungi and algae), part 2196. 4850. gbpln2197.seq - Plant sequence entries (including fungi and algae), part 2197. 4851. gbpln2198.seq - Plant sequence entries (including fungi and algae), part 2198. 4852. gbpln2199.seq - Plant sequence entries (including fungi and algae), part 2199. 4853. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22. 4854. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220. 4855. gbpln2200.seq - Plant sequence entries (including fungi and algae), part 2200. 4856. gbpln2201.seq - Plant sequence entries (including fungi and algae), part 2201. 4857. gbpln2202.seq - Plant sequence entries (including fungi and algae), part 2202. 4858. gbpln2203.seq - Plant sequence entries (including fungi and algae), part 2203. 4859. gbpln2204.seq - Plant sequence entries (including fungi and algae), part 2204. 4860. gbpln2205.seq - Plant sequence entries (including fungi and algae), part 2205. 4861. gbpln2206.seq - Plant sequence entries (including fungi and algae), part 2206. 4862. gbpln2207.seq - Plant sequence entries (including fungi and algae), part 2207. 4863. gbpln2208.seq - Plant sequence entries (including fungi and algae), part 2208. 4864. gbpln2209.seq - Plant sequence entries (including fungi and algae), part 2209. 4865. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221. 4866. gbpln2210.seq - Plant sequence entries (including fungi and algae), part 2210. 4867. gbpln2211.seq - Plant sequence entries (including fungi and algae), part 2211. 4868. gbpln2212.seq - Plant sequence entries (including fungi and algae), part 2212. 4869. gbpln2213.seq - Plant sequence entries (including fungi and algae), part 2213. 4870. gbpln2214.seq - Plant sequence entries (including fungi and algae), part 2214. 4871. gbpln2215.seq - Plant sequence entries (including fungi and algae), part 2215. 4872. gbpln2216.seq - Plant sequence entries (including fungi and algae), part 2216. 4873. gbpln2217.seq - Plant sequence entries (including fungi and algae), part 2217. 4874. gbpln2218.seq - Plant sequence entries (including fungi and algae), part 2218. 4875. gbpln2219.seq - Plant sequence entries (including fungi and algae), part 2219. 4876. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222. 4877. gbpln2220.seq - Plant sequence entries (including fungi and algae), part 2220. 4878. gbpln2221.seq - Plant sequence entries (including fungi and algae), part 2221. 4879. gbpln2222.seq - Plant sequence entries (including fungi and algae), part 2222. 4880. gbpln2223.seq - Plant sequence entries (including fungi and algae), part 2223. 4881. gbpln2224.seq - Plant sequence entries (including fungi and algae), part 2224. 4882. gbpln2225.seq - Plant sequence entries (including fungi and algae), part 2225. 4883. gbpln2226.seq - Plant sequence entries (including fungi and algae), part 2226. 4884. gbpln2227.seq - Plant sequence entries (including fungi and algae), part 2227. 4885. gbpln2228.seq - Plant sequence entries (including fungi and algae), part 2228. 4886. gbpln2229.seq - Plant sequence entries (including fungi and algae), part 2229. 4887. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223. 4888. gbpln2230.seq - Plant sequence entries (including fungi and algae), part 2230. 4889. gbpln2231.seq - Plant sequence entries (including fungi and algae), part 2231. 4890. gbpln2232.seq - Plant sequence entries (including fungi and algae), part 2232. 4891. gbpln2233.seq - Plant sequence entries (including fungi and algae), part 2233. 4892. gbpln2234.seq - Plant sequence entries (including fungi and algae), part 2234. 4893. gbpln2235.seq - Plant sequence entries (including fungi and algae), part 2235. 4894. gbpln2236.seq - Plant sequence entries (including fungi and algae), part 2236. 4895. gbpln2237.seq - Plant sequence entries (including fungi and algae), part 2237. 4896. gbpln2238.seq - Plant sequence entries (including fungi and algae), part 2238. 4897. gbpln2239.seq - Plant sequence entries (including fungi and algae), part 2239. 4898. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224. 4899. gbpln2240.seq - Plant sequence entries (including fungi and algae), part 2240. 4900. gbpln2241.seq - Plant sequence entries (including fungi and algae), part 2241. 4901. gbpln2242.seq - Plant sequence entries (including fungi and algae), part 2242. 4902. gbpln2243.seq - Plant sequence entries (including fungi and algae), part 2243. 4903. gbpln2244.seq - Plant sequence entries (including fungi and algae), part 2244. 4904. gbpln2245.seq - Plant sequence entries (including fungi and algae), part 2245. 4905. gbpln2246.seq - Plant sequence entries (including fungi and algae), part 2246. 4906. gbpln2247.seq - Plant sequence entries (including fungi and algae), part 2247. 4907. gbpln2248.seq - Plant sequence entries (including fungi and algae), part 2248. 4908. gbpln2249.seq - Plant sequence entries (including fungi and algae), part 2249. 4909. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225. 4910. gbpln2250.seq - Plant sequence entries (including fungi and algae), part 2250. 4911. gbpln2251.seq - Plant sequence entries (including fungi and algae), part 2251. 4912. gbpln2252.seq - Plant sequence entries (including fungi and algae), part 2252. 4913. gbpln2253.seq - Plant sequence entries (including fungi and algae), part 2253. 4914. gbpln2254.seq - Plant sequence entries (including fungi and algae), part 2254. 4915. gbpln2255.seq - Plant sequence entries (including fungi and algae), part 2255. 4916. gbpln2256.seq - Plant sequence entries (including fungi and algae), part 2256. 4917. gbpln2257.seq - Plant sequence entries (including fungi and algae), part 2257. 4918. gbpln2258.seq - Plant sequence entries (including fungi and algae), part 2258. 4919. gbpln2259.seq - Plant sequence entries (including fungi and algae), part 2259. 4920. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226. 4921. gbpln2260.seq - Plant sequence entries (including fungi and algae), part 2260. 4922. gbpln2261.seq - Plant sequence entries (including fungi and algae), part 2261. 4923. gbpln2262.seq - Plant sequence entries (including fungi and algae), part 2262. 4924. gbpln2263.seq - Plant sequence entries (including fungi and algae), part 2263. 4925. gbpln2264.seq - Plant sequence entries (including fungi and algae), part 2264. 4926. gbpln2265.seq - Plant sequence entries (including fungi and algae), part 2265. 4927. gbpln2266.seq - Plant sequence entries (including fungi and algae), part 2266. 4928. gbpln2267.seq - Plant sequence entries (including fungi and algae), part 2267. 4929. gbpln2268.seq - Plant sequence entries (including fungi and algae), part 2268. 4930. gbpln2269.seq - Plant sequence entries (including fungi and algae), part 2269. 4931. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227. 4932. gbpln2270.seq - Plant sequence entries (including fungi and algae), part 2270. 4933. gbpln2271.seq - Plant sequence entries (including fungi and algae), part 2271. 4934. gbpln2272.seq - Plant sequence entries (including fungi and algae), part 2272. 4935. gbpln2273.seq - Plant sequence entries (including fungi and algae), part 2273. 4936. gbpln2274.seq - Plant sequence entries (including fungi and algae), part 2274. 4937. gbpln2275.seq - Plant sequence entries (including fungi and algae), part 2275. 4938. gbpln2276.seq - Plant sequence entries (including fungi and algae), part 2276. 4939. gbpln2277.seq - Plant sequence entries (including fungi and algae), part 2277. 4940. gbpln2278.seq - Plant sequence entries (including fungi and algae), part 2278. 4941. gbpln2279.seq - Plant sequence entries (including fungi and algae), part 2279. 4942. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228. 4943. gbpln2280.seq - Plant sequence entries (including fungi and algae), part 2280. 4944. gbpln2281.seq - Plant sequence entries (including fungi and algae), part 2281. 4945. gbpln2282.seq - Plant sequence entries (including fungi and algae), part 2282. 4946. gbpln2283.seq - Plant sequence entries (including fungi and algae), part 2283. 4947. gbpln2284.seq - Plant sequence entries (including fungi and algae), part 2284. 4948. gbpln2285.seq - Plant sequence entries (including fungi and algae), part 2285. 4949. gbpln2286.seq - Plant sequence entries (including fungi and algae), part 2286. 4950. gbpln2287.seq - Plant sequence entries (including fungi and algae), part 2287. 4951. gbpln2288.seq - Plant sequence entries (including fungi and algae), part 2288. 4952. gbpln2289.seq - Plant sequence entries (including fungi and algae), part 2289. 4953. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229. 4954. gbpln2290.seq - Plant sequence entries (including fungi and algae), part 2290. 4955. gbpln2291.seq - Plant sequence entries (including fungi and algae), part 2291. 4956. gbpln2292.seq - Plant sequence entries (including fungi and algae), part 2292. 4957. gbpln2293.seq - Plant sequence entries (including fungi and algae), part 2293. 4958. gbpln2294.seq - Plant sequence entries (including fungi and algae), part 2294. 4959. gbpln2295.seq - Plant sequence entries (including fungi and algae), part 2295. 4960. gbpln2296.seq - Plant sequence entries (including fungi and algae), part 2296. 4961. gbpln2297.seq - Plant sequence entries (including fungi and algae), part 2297. 4962. gbpln2298.seq - Plant sequence entries (including fungi and algae), part 2298. 4963. gbpln2299.seq - Plant sequence entries (including fungi and algae), part 2299. 4964. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23. 4965. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230. 4966. gbpln2300.seq - Plant sequence entries (including fungi and algae), part 2300. 4967. gbpln2301.seq - Plant sequence entries (including fungi and algae), part 2301. 4968. gbpln2302.seq - Plant sequence entries (including fungi and algae), part 2302. 4969. gbpln2303.seq - Plant sequence entries (including fungi and algae), part 2303. 4970. gbpln2304.seq - Plant sequence entries (including fungi and algae), part 2304. 4971. gbpln2305.seq - Plant sequence entries (including fungi and algae), part 2305. 4972. gbpln2306.seq - Plant sequence entries (including fungi and algae), part 2306. 4973. gbpln2307.seq - Plant sequence entries (including fungi and algae), part 2307. 4974. gbpln2308.seq - Plant sequence entries (including fungi and algae), part 2308. 4975. gbpln2309.seq - Plant sequence entries (including fungi and algae), part 2309. 4976. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231. 4977. gbpln2310.seq - Plant sequence entries (including fungi and algae), part 2310. 4978. gbpln2311.seq - Plant sequence entries (including fungi and algae), part 2311. 4979. gbpln2312.seq - Plant sequence entries (including fungi and algae), part 2312. 4980. gbpln2313.seq - Plant sequence entries (including fungi and algae), part 2313. 4981. gbpln2314.seq - Plant sequence entries (including fungi and algae), part 2314. 4982. gbpln2315.seq - Plant sequence entries (including fungi and algae), part 2315. 4983. gbpln2316.seq - Plant sequence entries (including fungi and algae), part 2316. 4984. gbpln2317.seq - Plant sequence entries (including fungi and algae), part 2317. 4985. gbpln2318.seq - Plant sequence entries (including fungi and algae), part 2318. 4986. gbpln2319.seq - Plant sequence entries (including fungi and algae), part 2319. 4987. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232. 4988. gbpln2320.seq - Plant sequence entries (including fungi and algae), part 2320. 4989. gbpln2321.seq - Plant sequence entries (including fungi and algae), part 2321. 4990. gbpln2322.seq - Plant sequence entries (including fungi and algae), part 2322. 4991. gbpln2323.seq - Plant sequence entries (including fungi and algae), part 2323. 4992. gbpln2324.seq - Plant sequence entries (including fungi and algae), part 2324. 4993. gbpln2325.seq - Plant sequence entries (including fungi and algae), part 2325. 4994. gbpln2326.seq - Plant sequence entries (including fungi and algae), part 2326. 4995. gbpln2327.seq - Plant sequence entries (including fungi and algae), part 2327. 4996. gbpln2328.seq - Plant sequence entries (including fungi and algae), part 2328. 4997. gbpln2329.seq - Plant sequence entries (including fungi and algae), part 2329. 4998. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233. 4999. gbpln2330.seq - Plant sequence entries (including fungi and algae), part 2330. 5000. gbpln2331.seq - Plant sequence entries (including fungi and algae), part 2331. 5001. gbpln2332.seq - Plant sequence entries (including fungi and algae), part 2332. 5002. gbpln2333.seq - Plant sequence entries (including fungi and algae), part 2333. 5003. gbpln2334.seq - Plant sequence entries (including fungi and algae), part 2334. 5004. gbpln2335.seq - Plant sequence entries (including fungi and algae), part 2335. 5005. gbpln2336.seq - Plant sequence entries (including fungi and algae), part 2336. 5006. gbpln2337.seq - Plant sequence entries (including fungi and algae), part 2337. 5007. gbpln2338.seq - Plant sequence entries (including fungi and algae), part 2338. 5008. gbpln2339.seq - Plant sequence entries (including fungi and algae), part 2339. 5009. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234. 5010. gbpln2340.seq - Plant sequence entries (including fungi and algae), part 2340. 5011. gbpln2341.seq - Plant sequence entries (including fungi and algae), part 2341. 5012. gbpln2342.seq - Plant sequence entries (including fungi and algae), part 2342. 5013. gbpln2343.seq - Plant sequence entries (including fungi and algae), part 2343. 5014. gbpln2344.seq - Plant sequence entries (including fungi and algae), part 2344. 5015. gbpln2345.seq - Plant sequence entries (including fungi and algae), part 2345. 5016. gbpln2346.seq - Plant sequence entries (including fungi and algae), part 2346. 5017. gbpln2347.seq - Plant sequence entries (including fungi and algae), part 2347. 5018. gbpln2348.seq - Plant sequence entries (including fungi and algae), part 2348. 5019. gbpln2349.seq - Plant sequence entries (including fungi and algae), part 2349. 5020. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235. 5021. gbpln2350.seq - Plant sequence entries (including fungi and algae), part 2350. 5022. gbpln2351.seq - Plant sequence entries (including fungi and algae), part 2351. 5023. gbpln2352.seq - Plant sequence entries (including fungi and algae), part 2352. 5024. gbpln2353.seq - Plant sequence entries (including fungi and algae), part 2353. 5025. gbpln2354.seq - Plant sequence entries (including fungi and algae), part 2354. 5026. gbpln2355.seq - Plant sequence entries (including fungi and algae), part 2355. 5027. gbpln2356.seq - Plant sequence entries (including fungi and algae), part 2356. 5028. gbpln2357.seq - Plant sequence entries (including fungi and algae), part 2357. 5029. gbpln2358.seq - Plant sequence entries (including fungi and algae), part 2358. 5030. gbpln2359.seq - Plant sequence entries (including fungi and algae), part 2359. 5031. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236. 5032. gbpln2360.seq - Plant sequence entries (including fungi and algae), part 2360. 5033. gbpln2361.seq - Plant sequence entries (including fungi and algae), part 2361. 5034. gbpln2362.seq - Plant sequence entries (including fungi and algae), part 2362. 5035. gbpln2363.seq - Plant sequence entries (including fungi and algae), part 2363. 5036. gbpln2364.seq - Plant sequence entries (including fungi and algae), part 2364. 5037. gbpln2365.seq - Plant sequence entries (including fungi and algae), part 2365. 5038. gbpln2366.seq - Plant sequence entries (including fungi and algae), part 2366. 5039. gbpln2367.seq - Plant sequence entries (including fungi and algae), part 2367. 5040. gbpln2368.seq - Plant sequence entries (including fungi and algae), part 2368. 5041. gbpln2369.seq - Plant sequence entries (including fungi and algae), part 2369. 5042. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237. 5043. gbpln2370.seq - Plant sequence entries (including fungi and algae), part 2370. 5044. gbpln2371.seq - Plant sequence entries (including fungi and algae), part 2371. 5045. gbpln2372.seq - Plant sequence entries (including fungi and algae), part 2372. 5046. gbpln2373.seq - Plant sequence entries (including fungi and algae), part 2373. 5047. gbpln2374.seq - Plant sequence entries (including fungi and algae), part 2374. 5048. gbpln2375.seq - Plant sequence entries (including fungi and algae), part 2375. 5049. gbpln2376.seq - Plant sequence entries (including fungi and algae), part 2376. 5050. gbpln2377.seq - Plant sequence entries (including fungi and algae), part 2377. 5051. gbpln2378.seq - Plant sequence entries (including fungi and algae), part 2378. 5052. gbpln2379.seq - Plant sequence entries (including fungi and algae), part 2379. 5053. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238. 5054. gbpln2380.seq - Plant sequence entries (including fungi and algae), part 2380. 5055. gbpln2381.seq - Plant sequence entries (including fungi and algae), part 2381. 5056. gbpln2382.seq - Plant sequence entries (including fungi and algae), part 2382. 5057. gbpln2383.seq - Plant sequence entries (including fungi and algae), part 2383. 5058. gbpln2384.seq - Plant sequence entries (including fungi and algae), part 2384. 5059. gbpln2385.seq - Plant sequence entries (including fungi and algae), part 2385. 5060. gbpln2386.seq - Plant sequence entries (including fungi and algae), part 2386. 5061. gbpln2387.seq - Plant sequence entries (including fungi and algae), part 2387. 5062. gbpln2388.seq - Plant sequence entries (including fungi and algae), part 2388. 5063. gbpln2389.seq - Plant sequence entries (including fungi and algae), part 2389. 5064. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239. 5065. gbpln2390.seq - Plant sequence entries (including fungi and algae), part 2390. 5066. gbpln2391.seq - Plant sequence entries (including fungi and algae), part 2391. 5067. gbpln2392.seq - Plant sequence entries (including fungi and algae), part 2392. 5068. gbpln2393.seq - Plant sequence entries (including fungi and algae), part 2393. 5069. gbpln2394.seq - Plant sequence entries (including fungi and algae), part 2394. 5070. gbpln2395.seq - Plant sequence entries (including fungi and algae), part 2395. 5071. gbpln2396.seq - Plant sequence entries (including fungi and algae), part 2396. 5072. gbpln2397.seq - Plant sequence entries (including fungi and algae), part 2397. 5073. gbpln2398.seq - Plant sequence entries (including fungi and algae), part 2398. 5074. gbpln2399.seq - Plant sequence entries (including fungi and algae), part 2399. 5075. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24. 5076. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240. 5077. gbpln2400.seq - Plant sequence entries (including fungi and algae), part 2400. 5078. gbpln2401.seq - Plant sequence entries (including fungi and algae), part 2401. 5079. gbpln2402.seq - Plant sequence entries (including fungi and algae), part 2402. 5080. gbpln2403.seq - Plant sequence entries (including fungi and algae), part 2403. 5081. gbpln2404.seq - Plant sequence entries (including fungi and algae), part 2404. 5082. gbpln2405.seq - Plant sequence entries (including fungi and algae), part 2405. 5083. gbpln2406.seq - Plant sequence entries (including fungi and algae), part 2406. 5084. gbpln2407.seq - Plant sequence entries (including fungi and algae), part 2407. 5085. gbpln2408.seq - Plant sequence entries (including fungi and algae), part 2408. 5086. gbpln2409.seq - Plant sequence entries (including fungi and algae), part 2409. 5087. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241. 5088. gbpln2410.seq - Plant sequence entries (including fungi and algae), part 2410. 5089. gbpln2411.seq - Plant sequence entries (including fungi and algae), part 2411. 5090. gbpln2412.seq - Plant sequence entries (including fungi and algae), part 2412. 5091. gbpln2413.seq - Plant sequence entries (including fungi and algae), part 2413. 5092. gbpln2414.seq - Plant sequence entries (including fungi and algae), part 2414. 5093. gbpln2415.seq - Plant sequence entries (including fungi and algae), part 2415. 5094. gbpln2416.seq - Plant sequence entries (including fungi and algae), part 2416. 5095. gbpln2417.seq - Plant sequence entries (including fungi and algae), part 2417. 5096. gbpln2418.seq - Plant sequence entries (including fungi and algae), part 2418. 5097. gbpln2419.seq - Plant sequence entries (including fungi and algae), part 2419. 5098. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242. 5099. gbpln2420.seq - Plant sequence entries (including fungi and algae), part 2420. 5100. gbpln2421.seq - Plant sequence entries (including fungi and algae), part 2421. 5101. gbpln2422.seq - Plant sequence entries (including fungi and algae), part 2422. 5102. gbpln2423.seq - Plant sequence entries (including fungi and algae), part 2423. 5103. gbpln2424.seq - Plant sequence entries (including fungi and algae), part 2424. 5104. gbpln2425.seq - Plant sequence entries (including fungi and algae), part 2425. 5105. gbpln2426.seq - Plant sequence entries (including fungi and algae), part 2426. 5106. gbpln2427.seq - Plant sequence entries (including fungi and algae), part 2427. 5107. gbpln2428.seq - Plant sequence entries (including fungi and algae), part 2428. 5108. gbpln2429.seq - Plant sequence entries (including fungi and algae), part 2429. 5109. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243. 5110. gbpln2430.seq - Plant sequence entries (including fungi and algae), part 2430. 5111. gbpln2431.seq - Plant sequence entries (including fungi and algae), part 2431. 5112. gbpln2432.seq - Plant sequence entries (including fungi and algae), part 2432. 5113. gbpln2433.seq - Plant sequence entries (including fungi and algae), part 2433. 5114. gbpln2434.seq - Plant sequence entries (including fungi and algae), part 2434. 5115. gbpln2435.seq - Plant sequence entries (including fungi and algae), part 2435. 5116. gbpln2436.seq - Plant sequence entries (including fungi and algae), part 2436. 5117. gbpln2437.seq - Plant sequence entries (including fungi and algae), part 2437. 5118. gbpln2438.seq - Plant sequence entries (including fungi and algae), part 2438. 5119. gbpln2439.seq - Plant sequence entries (including fungi and algae), part 2439. 5120. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244. 5121. gbpln2440.seq - Plant sequence entries (including fungi and algae), part 2440. 5122. gbpln2441.seq - Plant sequence entries (including fungi and algae), part 2441. 5123. gbpln2442.seq - Plant sequence entries (including fungi and algae), part 2442. 5124. gbpln2443.seq - Plant sequence entries (including fungi and algae), part 2443. 5125. gbpln2444.seq - Plant sequence entries (including fungi and algae), part 2444. 5126. gbpln2445.seq - Plant sequence entries (including fungi and algae), part 2445. 5127. gbpln2446.seq - Plant sequence entries (including fungi and algae), part 2446. 5128. gbpln2447.seq - Plant sequence entries (including fungi and algae), part 2447. 5129. gbpln2448.seq - Plant sequence entries (including fungi and algae), part 2448. 5130. gbpln2449.seq - Plant sequence entries (including fungi and algae), part 2449. 5131. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245. 5132. gbpln2450.seq - Plant sequence entries (including fungi and algae), part 2450. 5133. gbpln2451.seq - Plant sequence entries (including fungi and algae), part 2451. 5134. gbpln2452.seq - Plant sequence entries (including fungi and algae), part 2452. 5135. gbpln2453.seq - Plant sequence entries (including fungi and algae), part 2453. 5136. gbpln2454.seq - Plant sequence entries (including fungi and algae), part 2454. 5137. gbpln2455.seq - Plant sequence entries (including fungi and algae), part 2455. 5138. gbpln2456.seq - Plant sequence entries (including fungi and algae), part 2456. 5139. gbpln2457.seq - Plant sequence entries (including fungi and algae), part 2457. 5140. gbpln2458.seq - Plant sequence entries (including fungi and algae), part 2458. 5141. gbpln2459.seq - Plant sequence entries (including fungi and algae), part 2459. 5142. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246. 5143. gbpln2460.seq - Plant sequence entries (including fungi and algae), part 2460. 5144. gbpln2461.seq - Plant sequence entries (including fungi and algae), part 2461. 5145. gbpln2462.seq - Plant sequence entries (including fungi and algae), part 2462. 5146. gbpln2463.seq - Plant sequence entries (including fungi and algae), part 2463. 5147. gbpln2464.seq - Plant sequence entries (including fungi and algae), part 2464. 5148. gbpln2465.seq - Plant sequence entries (including fungi and algae), part 2465. 5149. gbpln2466.seq - Plant sequence entries (including fungi and algae), part 2466. 5150. gbpln2467.seq - Plant sequence entries (including fungi and algae), part 2467. 5151. gbpln2468.seq - Plant sequence entries (including fungi and algae), part 2468. 5152. gbpln2469.seq - Plant sequence entries (including fungi and algae), part 2469. 5153. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247. 5154. gbpln2470.seq - Plant sequence entries (including fungi and algae), part 2470. 5155. gbpln2471.seq - Plant sequence entries (including fungi and algae), part 2471. 5156. gbpln2472.seq - Plant sequence entries (including fungi and algae), part 2472. 5157. gbpln2473.seq - Plant sequence entries (including fungi and algae), part 2473. 5158. gbpln2474.seq - Plant sequence entries (including fungi and algae), part 2474. 5159. gbpln2475.seq - Plant sequence entries (including fungi and algae), part 2475. 5160. gbpln2476.seq - Plant sequence entries (including fungi and algae), part 2476. 5161. gbpln2477.seq - Plant sequence entries (including fungi and algae), part 2477. 5162. gbpln2478.seq - Plant sequence entries (including fungi and algae), part 2478. 5163. gbpln2479.seq - Plant sequence entries (including fungi and algae), part 2479. 5164. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248. 5165. gbpln2480.seq - Plant sequence entries (including fungi and algae), part 2480. 5166. gbpln2481.seq - Plant sequence entries (including fungi and algae), part 2481. 5167. gbpln2482.seq - Plant sequence entries (including fungi and algae), part 2482. 5168. gbpln2483.seq - Plant sequence entries (including fungi and algae), part 2483. 5169. gbpln2484.seq - Plant sequence entries (including fungi and algae), part 2484. 5170. gbpln2485.seq - Plant sequence entries (including fungi and algae), part 2485. 5171. gbpln2486.seq - Plant sequence entries (including fungi and algae), part 2486. 5172. gbpln2487.seq - Plant sequence entries (including fungi and algae), part 2487. 5173. gbpln2488.seq - Plant sequence entries (including fungi and algae), part 2488. 5174. gbpln2489.seq - Plant sequence entries (including fungi and algae), part 2489. 5175. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249. 5176. gbpln2490.seq - Plant sequence entries (including fungi and algae), part 2490. 5177. gbpln2491.seq - Plant sequence entries (including fungi and algae), part 2491. 5178. gbpln2492.seq - Plant sequence entries (including fungi and algae), part 2492. 5179. gbpln2493.seq - Plant sequence entries (including fungi and algae), part 2493. 5180. gbpln2494.seq - Plant sequence entries (including fungi and algae), part 2494. 5181. gbpln2495.seq - Plant sequence entries (including fungi and algae), part 2495. 5182. gbpln2496.seq - Plant sequence entries (including fungi and algae), part 2496. 5183. gbpln2497.seq - Plant sequence entries (including fungi and algae), part 2497. 5184. gbpln2498.seq - Plant sequence entries (including fungi and algae), part 2498. 5185. gbpln2499.seq - Plant sequence entries (including fungi and algae), part 2499. 5186. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25. 5187. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250. 5188. gbpln2500.seq - Plant sequence entries (including fungi and algae), part 2500. 5189. gbpln2501.seq - Plant sequence entries (including fungi and algae), part 2501. 5190. gbpln2502.seq - Plant sequence entries (including fungi and algae), part 2502. 5191. gbpln2503.seq - Plant sequence entries (including fungi and algae), part 2503. 5192. gbpln2504.seq - Plant sequence entries (including fungi and algae), part 2504. 5193. gbpln2505.seq - Plant sequence entries (including fungi and algae), part 2505. 5194. gbpln2506.seq - Plant sequence entries (including fungi and algae), part 2506. 5195. gbpln2507.seq - Plant sequence entries (including fungi and algae), part 2507. 5196. gbpln2508.seq - Plant sequence entries (including fungi and algae), part 2508. 5197. gbpln2509.seq - Plant sequence entries (including fungi and algae), part 2509. 5198. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251. 5199. gbpln2510.seq - Plant sequence entries (including fungi and algae), part 2510. 5200. gbpln2511.seq - Plant sequence entries (including fungi and algae), part 2511. 5201. gbpln2512.seq - Plant sequence entries (including fungi and algae), part 2512. 5202. gbpln2513.seq - Plant sequence entries (including fungi and algae), part 2513. 5203. gbpln2514.seq - Plant sequence entries (including fungi and algae), part 2514. 5204. gbpln2515.seq - Plant sequence entries (including fungi and algae), part 2515. 5205. gbpln2516.seq - Plant sequence entries (including fungi and algae), part 2516. 5206. gbpln2517.seq - Plant sequence entries (including fungi and algae), part 2517. 5207. gbpln2518.seq - Plant sequence entries (including fungi and algae), part 2518. 5208. gbpln2519.seq - Plant sequence entries (including fungi and algae), part 2519. 5209. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252. 5210. gbpln2520.seq - Plant sequence entries (including fungi and algae), part 2520. 5211. gbpln2521.seq - Plant sequence entries (including fungi and algae), part 2521. 5212. gbpln2522.seq - Plant sequence entries (including fungi and algae), part 2522. 5213. gbpln2523.seq - Plant sequence entries (including fungi and algae), part 2523. 5214. gbpln2524.seq - Plant sequence entries (including fungi and algae), part 2524. 5215. gbpln2525.seq - Plant sequence entries (including fungi and algae), part 2525. 5216. gbpln2526.seq - Plant sequence entries (including fungi and algae), part 2526. 5217. gbpln2527.seq - Plant sequence entries (including fungi and algae), part 2527. 5218. gbpln2528.seq - Plant sequence entries (including fungi and algae), part 2528. 5219. gbpln2529.seq - Plant sequence entries (including fungi and algae), part 2529. 5220. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253. 5221. gbpln2530.seq - Plant sequence entries (including fungi and algae), part 2530. 5222. gbpln2531.seq - Plant sequence entries (including fungi and algae), part 2531. 5223. gbpln2532.seq - Plant sequence entries (including fungi and algae), part 2532. 5224. gbpln2533.seq - Plant sequence entries (including fungi and algae), part 2533. 5225. gbpln2534.seq - Plant sequence entries (including fungi and algae), part 2534. 5226. gbpln2535.seq - Plant sequence entries (including fungi and algae), part 2535. 5227. gbpln2536.seq - Plant sequence entries (including fungi and algae), part 2536. 5228. gbpln2537.seq - Plant sequence entries (including fungi and algae), part 2537. 5229. gbpln2538.seq - Plant sequence entries (including fungi and algae), part 2538. 5230. gbpln2539.seq - Plant sequence entries (including fungi and algae), part 2539. 5231. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254. 5232. gbpln2540.seq - Plant sequence entries (including fungi and algae), part 2540. 5233. gbpln2541.seq - Plant sequence entries (including fungi and algae), part 2541. 5234. gbpln2542.seq - Plant sequence entries (including fungi and algae), part 2542. 5235. gbpln2543.seq - Plant sequence entries (including fungi and algae), part 2543. 5236. gbpln2544.seq - Plant sequence entries (including fungi and algae), part 2544. 5237. gbpln2545.seq - Plant sequence entries (including fungi and algae), part 2545. 5238. gbpln2546.seq - Plant sequence entries (including fungi and algae), part 2546. 5239. gbpln2547.seq - Plant sequence entries (including fungi and algae), part 2547. 5240. gbpln2548.seq - Plant sequence entries (including fungi and algae), part 2548. 5241. gbpln2549.seq - Plant sequence entries (including fungi and algae), part 2549. 5242. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255. 5243. gbpln2550.seq - Plant sequence entries (including fungi and algae), part 2550. 5244. gbpln2551.seq - Plant sequence entries (including fungi and algae), part 2551. 5245. gbpln2552.seq - Plant sequence entries (including fungi and algae), part 2552. 5246. gbpln2553.seq - Plant sequence entries (including fungi and algae), part 2553. 5247. gbpln2554.seq - Plant sequence entries (including fungi and algae), part 2554. 5248. gbpln2555.seq - Plant sequence entries (including fungi and algae), part 2555. 5249. gbpln2556.seq - Plant sequence entries (including fungi and algae), part 2556. 5250. gbpln2557.seq - Plant sequence entries (including fungi and algae), part 2557. 5251. gbpln2558.seq - Plant sequence entries (including fungi and algae), part 2558. 5252. gbpln2559.seq - Plant sequence entries (including fungi and algae), part 2559. 5253. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256. 5254. gbpln2560.seq - Plant sequence entries (including fungi and algae), part 2560. 5255. gbpln2561.seq - Plant sequence entries (including fungi and algae), part 2561. 5256. gbpln2562.seq - Plant sequence entries (including fungi and algae), part 2562. 5257. gbpln2563.seq - Plant sequence entries (including fungi and algae), part 2563. 5258. gbpln2564.seq - Plant sequence entries (including fungi and algae), part 2564. 5259. gbpln2565.seq - Plant sequence entries (including fungi and algae), part 2565. 5260. gbpln2566.seq - Plant sequence entries (including fungi and algae), part 2566. 5261. gbpln2567.seq - Plant sequence entries (including fungi and algae), part 2567. 5262. gbpln2568.seq - Plant sequence entries (including fungi and algae), part 2568. 5263. gbpln2569.seq - Plant sequence entries (including fungi and algae), part 2569. 5264. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257. 5265. gbpln2570.seq - Plant sequence entries (including fungi and algae), part 2570. 5266. gbpln2571.seq - Plant sequence entries (including fungi and algae), part 2571. 5267. gbpln2572.seq - Plant sequence entries (including fungi and algae), part 2572. 5268. gbpln2573.seq - Plant sequence entries (including fungi and algae), part 2573. 5269. gbpln2574.seq - Plant sequence entries (including fungi and algae), part 2574. 5270. gbpln2575.seq - Plant sequence entries (including fungi and algae), part 2575. 5271. gbpln2576.seq - Plant sequence entries (including fungi and algae), part 2576. 5272. gbpln2577.seq - Plant sequence entries (including fungi and algae), part 2577. 5273. gbpln2578.seq - Plant sequence entries (including fungi and algae), part 2578. 5274. gbpln2579.seq - Plant sequence entries (including fungi and algae), part 2579. 5275. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258. 5276. gbpln2580.seq - Plant sequence entries (including fungi and algae), part 2580. 5277. gbpln2581.seq - Plant sequence entries (including fungi and algae), part 2581. 5278. gbpln2582.seq - Plant sequence entries (including fungi and algae), part 2582. 5279. gbpln2583.seq - Plant sequence entries (including fungi and algae), part 2583. 5280. gbpln2584.seq - Plant sequence entries (including fungi and algae), part 2584. 5281. gbpln2585.seq - Plant sequence entries (including fungi and algae), part 2585. 5282. gbpln2586.seq - Plant sequence entries (including fungi and algae), part 2586. 5283. gbpln2587.seq - Plant sequence entries (including fungi and algae), part 2587. 5284. gbpln2588.seq - Plant sequence entries (including fungi and algae), part 2588. 5285. gbpln2589.seq - Plant sequence entries (including fungi and algae), part 2589. 5286. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259. 5287. gbpln2590.seq - Plant sequence entries (including fungi and algae), part 2590. 5288. gbpln2591.seq - Plant sequence entries (including fungi and algae), part 2591. 5289. gbpln2592.seq - Plant sequence entries (including fungi and algae), part 2592. 5290. gbpln2593.seq - Plant sequence entries (including fungi and algae), part 2593. 5291. gbpln2594.seq - Plant sequence entries (including fungi and algae), part 2594. 5292. gbpln2595.seq - Plant sequence entries (including fungi and algae), part 2595. 5293. gbpln2596.seq - Plant sequence entries (including fungi and algae), part 2596. 5294. gbpln2597.seq - Plant sequence entries (including fungi and algae), part 2597. 5295. gbpln2598.seq - Plant sequence entries (including fungi and algae), part 2598. 5296. gbpln2599.seq - Plant sequence entries (including fungi and algae), part 2599. 5297. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26. 5298. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260. 5299. gbpln2600.seq - Plant sequence entries (including fungi and algae), part 2600. 5300. gbpln2601.seq - Plant sequence entries (including fungi and algae), part 2601. 5301. gbpln2602.seq - Plant sequence entries (including fungi and algae), part 2602. 5302. gbpln2603.seq - Plant sequence entries (including fungi and algae), part 2603. 5303. gbpln2604.seq - Plant sequence entries (including fungi and algae), part 2604. 5304. gbpln2605.seq - Plant sequence entries (including fungi and algae), part 2605. 5305. gbpln2606.seq - Plant sequence entries (including fungi and algae), part 2606. 5306. gbpln2607.seq - Plant sequence entries (including fungi and algae), part 2607. 5307. gbpln2608.seq - Plant sequence entries (including fungi and algae), part 2608. 5308. gbpln2609.seq - Plant sequence entries (including fungi and algae), part 2609. 5309. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261. 5310. gbpln2610.seq - Plant sequence entries (including fungi and algae), part 2610. 5311. gbpln2611.seq - Plant sequence entries (including fungi and algae), part 2611. 5312. gbpln2612.seq - Plant sequence entries (including fungi and algae), part 2612. 5313. gbpln2613.seq - Plant sequence entries (including fungi and algae), part 2613. 5314. gbpln2614.seq - Plant sequence entries (including fungi and algae), part 2614. 5315. gbpln2615.seq - Plant sequence entries (including fungi and algae), part 2615. 5316. gbpln2616.seq - Plant sequence entries (including fungi and algae), part 2616. 5317. gbpln2617.seq - Plant sequence entries (including fungi and algae), part 2617. 5318. gbpln2618.seq - Plant sequence entries (including fungi and algae), part 2618. 5319. gbpln2619.seq - Plant sequence entries (including fungi and algae), part 2619. 5320. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262. 5321. gbpln2620.seq - Plant sequence entries (including fungi and algae), part 2620. 5322. gbpln2621.seq - Plant sequence entries (including fungi and algae), part 2621. 5323. gbpln2622.seq - Plant sequence entries (including fungi and algae), part 2622. 5324. gbpln2623.seq - Plant sequence entries (including fungi and algae), part 2623. 5325. gbpln2624.seq - Plant sequence entries (including fungi and algae), part 2624. 5326. gbpln2625.seq - Plant sequence entries (including fungi and algae), part 2625. 5327. gbpln2626.seq - Plant sequence entries (including fungi and algae), part 2626. 5328. gbpln2627.seq - Plant sequence entries (including fungi and algae), part 2627. 5329. gbpln2628.seq - Plant sequence entries (including fungi and algae), part 2628. 5330. gbpln2629.seq - Plant sequence entries (including fungi and algae), part 2629. 5331. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263. 5332. gbpln2630.seq - Plant sequence entries (including fungi and algae), part 2630. 5333. gbpln2631.seq - Plant sequence entries (including fungi and algae), part 2631. 5334. gbpln2632.seq - Plant sequence entries (including fungi and algae), part 2632. 5335. gbpln2633.seq - Plant sequence entries (including fungi and algae), part 2633. 5336. gbpln2634.seq - Plant sequence entries (including fungi and algae), part 2634. 5337. gbpln2635.seq - Plant sequence entries (including fungi and algae), part 2635. 5338. gbpln2636.seq - Plant sequence entries (including fungi and algae), part 2636. 5339. gbpln2637.seq - Plant sequence entries (including fungi and algae), part 2637. 5340. gbpln2638.seq - Plant sequence entries (including fungi and algae), part 2638. 5341. gbpln2639.seq - Plant sequence entries (including fungi and algae), part 2639. 5342. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264. 5343. gbpln2640.seq - Plant sequence entries (including fungi and algae), part 2640. 5344. gbpln2641.seq - Plant sequence entries (including fungi and algae), part 2641. 5345. gbpln2642.seq - Plant sequence entries (including fungi and algae), part 2642. 5346. gbpln2643.seq - Plant sequence entries (including fungi and algae), part 2643. 5347. gbpln2644.seq - Plant sequence entries (including fungi and algae), part 2644. 5348. gbpln2645.seq - Plant sequence entries (including fungi and algae), part 2645. 5349. gbpln2646.seq - Plant sequence entries (including fungi and algae), part 2646. 5350. gbpln2647.seq - Plant sequence entries (including fungi and algae), part 2647. 5351. gbpln2648.seq - Plant sequence entries (including fungi and algae), part 2648. 5352. gbpln2649.seq - Plant sequence entries (including fungi and algae), part 2649. 5353. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265. 5354. gbpln2650.seq - Plant sequence entries (including fungi and algae), part 2650. 5355. gbpln2651.seq - Plant sequence entries (including fungi and algae), part 2651. 5356. gbpln2652.seq - Plant sequence entries (including fungi and algae), part 2652. 5357. gbpln2653.seq - Plant sequence entries (including fungi and algae), part 2653. 5358. gbpln2654.seq - Plant sequence entries (including fungi and algae), part 2654. 5359. gbpln2655.seq - Plant sequence entries (including fungi and algae), part 2655. 5360. gbpln2656.seq - Plant sequence entries (including fungi and algae), part 2656. 5361. gbpln2657.seq - Plant sequence entries (including fungi and algae), part 2657. 5362. gbpln2658.seq - Plant sequence entries (including fungi and algae), part 2658. 5363. gbpln2659.seq - Plant sequence entries (including fungi and algae), part 2659. 5364. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266. 5365. gbpln2660.seq - Plant sequence entries (including fungi and algae), part 2660. 5366. gbpln2661.seq - Plant sequence entries (including fungi and algae), part 2661. 5367. gbpln2662.seq - Plant sequence entries (including fungi and algae), part 2662. 5368. gbpln2663.seq - Plant sequence entries (including fungi and algae), part 2663. 5369. gbpln2664.seq - Plant sequence entries (including fungi and algae), part 2664. 5370. gbpln2665.seq - Plant sequence entries (including fungi and algae), part 2665. 5371. gbpln2666.seq - Plant sequence entries (including fungi and algae), part 2666. 5372. gbpln2667.seq - Plant sequence entries (including fungi and algae), part 2667. 5373. gbpln2668.seq - Plant sequence entries (including fungi and algae), part 2668. 5374. gbpln2669.seq - Plant sequence entries (including fungi and algae), part 2669. 5375. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267. 5376. gbpln2670.seq - Plant sequence entries (including fungi and algae), part 2670. 5377. gbpln2671.seq - Plant sequence entries (including fungi and algae), part 2671. 5378. gbpln2672.seq - Plant sequence entries (including fungi and algae), part 2672. 5379. gbpln2673.seq - Plant sequence entries (including fungi and algae), part 2673. 5380. gbpln2674.seq - Plant sequence entries (including fungi and algae), part 2674. 5381. gbpln2675.seq - Plant sequence entries (including fungi and algae), part 2675. 5382. gbpln2676.seq - Plant sequence entries (including fungi and algae), part 2676. 5383. gbpln2677.seq - Plant sequence entries (including fungi and algae), part 2677. 5384. gbpln2678.seq - Plant sequence entries (including fungi and algae), part 2678. 5385. gbpln2679.seq - Plant sequence entries (including fungi and algae), part 2679. 5386. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268. 5387. gbpln2680.seq - Plant sequence entries (including fungi and algae), part 2680. 5388. gbpln2681.seq - Plant sequence entries (including fungi and algae), part 2681. 5389. gbpln2682.seq - Plant sequence entries (including fungi and algae), part 2682. 5390. gbpln2683.seq - Plant sequence entries (including fungi and algae), part 2683. 5391. gbpln2684.seq - Plant sequence entries (including fungi and algae), part 2684. 5392. gbpln2685.seq - Plant sequence entries (including fungi and algae), part 2685. 5393. gbpln2686.seq - Plant sequence entries (including fungi and algae), part 2686. 5394. gbpln2687.seq - Plant sequence entries (including fungi and algae), part 2687. 5395. gbpln2688.seq - Plant sequence entries (including fungi and algae), part 2688. 5396. gbpln2689.seq - Plant sequence entries (including fungi and algae), part 2689. 5397. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269. 5398. gbpln2690.seq - Plant sequence entries (including fungi and algae), part 2690. 5399. gbpln2691.seq - Plant sequence entries (including fungi and algae), part 2691. 5400. gbpln2692.seq - Plant sequence entries (including fungi and algae), part 2692. 5401. gbpln2693.seq - Plant sequence entries (including fungi and algae), part 2693. 5402. gbpln2694.seq - Plant sequence entries (including fungi and algae), part 2694. 5403. gbpln2695.seq - Plant sequence entries (including fungi and algae), part 2695. 5404. gbpln2696.seq - Plant sequence entries (including fungi and algae), part 2696. 5405. gbpln2697.seq - Plant sequence entries (including fungi and algae), part 2697. 5406. gbpln2698.seq - Plant sequence entries (including fungi and algae), part 2698. 5407. gbpln2699.seq - Plant sequence entries (including fungi and algae), part 2699. 5408. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27. 5409. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270. 5410. gbpln2700.seq - Plant sequence entries (including fungi and algae), part 2700. 5411. gbpln2701.seq - Plant sequence entries (including fungi and algae), part 2701. 5412. gbpln2702.seq - Plant sequence entries (including fungi and algae), part 2702. 5413. gbpln2703.seq - Plant sequence entries (including fungi and algae), part 2703. 5414. gbpln2704.seq - Plant sequence entries (including fungi and algae), part 2704. 5415. gbpln2705.seq - Plant sequence entries (including fungi and algae), part 2705. 5416. gbpln2706.seq - Plant sequence entries (including fungi and algae), part 2706. 5417. gbpln2707.seq - Plant sequence entries (including fungi and algae), part 2707. 5418. gbpln2708.seq - Plant sequence entries (including fungi and algae), part 2708. 5419. gbpln2709.seq - Plant sequence entries (including fungi and algae), part 2709. 5420. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271. 5421. gbpln2710.seq - Plant sequence entries (including fungi and algae), part 2710. 5422. gbpln2711.seq - Plant sequence entries (including fungi and algae), part 2711. 5423. gbpln2712.seq - Plant sequence entries (including fungi and algae), part 2712. 5424. gbpln2713.seq - Plant sequence entries (including fungi and algae), part 2713. 5425. gbpln2714.seq - Plant sequence entries (including fungi and algae), part 2714. 5426. gbpln2715.seq - Plant sequence entries (including fungi and algae), part 2715. 5427. gbpln2716.seq - Plant sequence entries (including fungi and algae), part 2716. 5428. gbpln2717.seq - Plant sequence entries (including fungi and algae), part 2717. 5429. gbpln2718.seq - Plant sequence entries (including fungi and algae), part 2718. 5430. gbpln2719.seq - Plant sequence entries (including fungi and algae), part 2719. 5431. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272. 5432. gbpln2720.seq - Plant sequence entries (including fungi and algae), part 2720. 5433. gbpln2721.seq - Plant sequence entries (including fungi and algae), part 2721. 5434. gbpln2722.seq - Plant sequence entries (including fungi and algae), part 2722. 5435. gbpln2723.seq - Plant sequence entries (including fungi and algae), part 2723. 5436. gbpln2724.seq - Plant sequence entries (including fungi and algae), part 2724. 5437. gbpln2725.seq - Plant sequence entries (including fungi and algae), part 2725. 5438. gbpln2726.seq - Plant sequence entries (including fungi and algae), part 2726. 5439. gbpln2727.seq - Plant sequence entries (including fungi and algae), part 2727. 5440. gbpln2728.seq - Plant sequence entries (including fungi and algae), part 2728. 5441. gbpln2729.seq - Plant sequence entries (including fungi and algae), part 2729. 5442. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273. 5443. gbpln2730.seq - Plant sequence entries (including fungi and algae), part 2730. 5444. gbpln2731.seq - Plant sequence entries (including fungi and algae), part 2731. 5445. gbpln2732.seq - Plant sequence entries (including fungi and algae), part 2732. 5446. gbpln2733.seq - Plant sequence entries (including fungi and algae), part 2733. 5447. gbpln2734.seq - Plant sequence entries (including fungi and algae), part 2734. 5448. gbpln2735.seq - Plant sequence entries (including fungi and algae), part 2735. 5449. gbpln2736.seq - Plant sequence entries (including fungi and algae), part 2736. 5450. gbpln2737.seq - Plant sequence entries (including fungi and algae), part 2737. 5451. gbpln2738.seq - Plant sequence entries (including fungi and algae), part 2738. 5452. gbpln2739.seq - Plant sequence entries (including fungi and algae), part 2739. 5453. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274. 5454. gbpln2740.seq - Plant sequence entries (including fungi and algae), part 2740. 5455. gbpln2741.seq - Plant sequence entries (including fungi and algae), part 2741. 5456. gbpln2742.seq - Plant sequence entries (including fungi and algae), part 2742. 5457. gbpln2743.seq - Plant sequence entries (including fungi and algae), part 2743. 5458. gbpln2744.seq - Plant sequence entries (including fungi and algae), part 2744. 5459. gbpln2745.seq - Plant sequence entries (including fungi and algae), part 2745. 5460. gbpln2746.seq - Plant sequence entries (including fungi and algae), part 2746. 5461. gbpln2747.seq - Plant sequence entries (including fungi and algae), part 2747. 5462. gbpln2748.seq - Plant sequence entries (including fungi and algae), part 2748. 5463. gbpln2749.seq - Plant sequence entries (including fungi and algae), part 2749. 5464. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275. 5465. gbpln2750.seq - Plant sequence entries (including fungi and algae), part 2750. 5466. gbpln2751.seq - Plant sequence entries (including fungi and algae), part 2751. 5467. gbpln2752.seq - Plant sequence entries (including fungi and algae), part 2752. 5468. gbpln2753.seq - Plant sequence entries (including fungi and algae), part 2753. 5469. gbpln2754.seq - Plant sequence entries (including fungi and algae), part 2754. 5470. gbpln2755.seq - Plant sequence entries (including fungi and algae), part 2755. 5471. gbpln2756.seq - Plant sequence entries (including fungi and algae), part 2756. 5472. gbpln2757.seq - Plant sequence entries (including fungi and algae), part 2757. 5473. gbpln2758.seq - Plant sequence entries (including fungi and algae), part 2758. 5474. gbpln2759.seq - Plant sequence entries (including fungi and algae), part 2759. 5475. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276. 5476. gbpln2760.seq - Plant sequence entries (including fungi and algae), part 2760. 5477. gbpln2761.seq - Plant sequence entries (including fungi and algae), part 2761. 5478. gbpln2762.seq - Plant sequence entries (including fungi and algae), part 2762. 5479. gbpln2763.seq - Plant sequence entries (including fungi and algae), part 2763. 5480. gbpln2764.seq - Plant sequence entries (including fungi and algae), part 2764. 5481. gbpln2765.seq - Plant sequence entries (including fungi and algae), part 2765. 5482. gbpln2766.seq - Plant sequence entries (including fungi and algae), part 2766. 5483. gbpln2767.seq - Plant sequence entries (including fungi and algae), part 2767. 5484. gbpln2768.seq - Plant sequence entries (including fungi and algae), part 2768. 5485. gbpln2769.seq - Plant sequence entries (including fungi and algae), part 2769. 5486. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277. 5487. gbpln2770.seq - Plant sequence entries (including fungi and algae), part 2770. 5488. gbpln2771.seq - Plant sequence entries (including fungi and algae), part 2771. 5489. gbpln2772.seq - Plant sequence entries (including fungi and algae), part 2772. 5490. gbpln2773.seq - Plant sequence entries (including fungi and algae), part 2773. 5491. gbpln2774.seq - Plant sequence entries (including fungi and algae), part 2774. 5492. gbpln2775.seq - Plant sequence entries (including fungi and algae), part 2775. 5493. gbpln2776.seq - Plant sequence entries (including fungi and algae), part 2776. 5494. gbpln2777.seq - Plant sequence entries (including fungi and algae), part 2777. 5495. gbpln2778.seq - Plant sequence entries (including fungi and algae), part 2778. 5496. gbpln2779.seq - Plant sequence entries (including fungi and algae), part 2779. 5497. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278. 5498. gbpln2780.seq - Plant sequence entries (including fungi and algae), part 2780. 5499. gbpln2781.seq - Plant sequence entries (including fungi and algae), part 2781. 5500. gbpln2782.seq - Plant sequence entries (including fungi and algae), part 2782. 5501. gbpln2783.seq - Plant sequence entries (including fungi and algae), part 2783. 5502. gbpln2784.seq - Plant sequence entries (including fungi and algae), part 2784. 5503. gbpln2785.seq - Plant sequence entries (including fungi and algae), part 2785. 5504. gbpln2786.seq - Plant sequence entries (including fungi and algae), part 2786. 5505. gbpln2787.seq - Plant sequence entries (including fungi and algae), part 2787. 5506. gbpln2788.seq - Plant sequence entries (including fungi and algae), part 2788. 5507. gbpln2789.seq - Plant sequence entries (including fungi and algae), part 2789. 5508. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279. 5509. gbpln2790.seq - Plant sequence entries (including fungi and algae), part 2790. 5510. gbpln2791.seq - Plant sequence entries (including fungi and algae), part 2791. 5511. gbpln2792.seq - Plant sequence entries (including fungi and algae), part 2792. 5512. gbpln2793.seq - Plant sequence entries (including fungi and algae), part 2793. 5513. gbpln2794.seq - Plant sequence entries (including fungi and algae), part 2794. 5514. gbpln2795.seq - Plant sequence entries (including fungi and algae), part 2795. 5515. gbpln2796.seq - Plant sequence entries (including fungi and algae), part 2796. 5516. gbpln2797.seq - Plant sequence entries (including fungi and algae), part 2797. 5517. gbpln2798.seq - Plant sequence entries (including fungi and algae), part 2798. 5518. gbpln2799.seq - Plant sequence entries (including fungi and algae), part 2799. 5519. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28. 5520. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280. 5521. gbpln2800.seq - Plant sequence entries (including fungi and algae), part 2800. 5522. gbpln2801.seq - Plant sequence entries (including fungi and algae), part 2801. 5523. gbpln2802.seq - Plant sequence entries (including fungi and algae), part 2802. 5524. gbpln2803.seq - Plant sequence entries (including fungi and algae), part 2803. 5525. gbpln2804.seq - Plant sequence entries (including fungi and algae), part 2804. 5526. gbpln2805.seq - Plant sequence entries (including fungi and algae), part 2805. 5527. gbpln2806.seq - Plant sequence entries (including fungi and algae), part 2806. 5528. gbpln2807.seq - Plant sequence entries (including fungi and algae), part 2807. 5529. gbpln2808.seq - Plant sequence entries (including fungi and algae), part 2808. 5530. gbpln2809.seq - Plant sequence entries (including fungi and algae), part 2809. 5531. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281. 5532. gbpln2810.seq - Plant sequence entries (including fungi and algae), part 2810. 5533. gbpln2811.seq - Plant sequence entries (including fungi and algae), part 2811. 5534. gbpln2812.seq - Plant sequence entries (including fungi and algae), part 2812. 5535. gbpln2813.seq - Plant sequence entries (including fungi and algae), part 2813. 5536. gbpln2814.seq - Plant sequence entries (including fungi and algae), part 2814. 5537. gbpln2815.seq - Plant sequence entries (including fungi and algae), part 2815. 5538. gbpln2816.seq - Plant sequence entries (including fungi and algae), part 2816. 5539. gbpln2817.seq - Plant sequence entries (including fungi and algae), part 2817. 5540. gbpln2818.seq - Plant sequence entries (including fungi and algae), part 2818. 5541. gbpln2819.seq - Plant sequence entries (including fungi and algae), part 2819. 5542. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282. 5543. gbpln2820.seq - Plant sequence entries (including fungi and algae), part 2820. 5544. gbpln2821.seq - Plant sequence entries (including fungi and algae), part 2821. 5545. gbpln2822.seq - Plant sequence entries (including fungi and algae), part 2822. 5546. gbpln2823.seq - Plant sequence entries (including fungi and algae), part 2823. 5547. gbpln2824.seq - Plant sequence entries (including fungi and algae), part 2824. 5548. gbpln2825.seq - Plant sequence entries (including fungi and algae), part 2825. 5549. gbpln2826.seq - Plant sequence entries (including fungi and algae), part 2826. 5550. gbpln2827.seq - Plant sequence entries (including fungi and algae), part 2827. 5551. gbpln2828.seq - Plant sequence entries (including fungi and algae), part 2828. 5552. gbpln2829.seq - Plant sequence entries (including fungi and algae), part 2829. 5553. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283. 5554. gbpln2830.seq - Plant sequence entries (including fungi and algae), part 2830. 5555. gbpln2831.seq - Plant sequence entries (including fungi and algae), part 2831. 5556. gbpln2832.seq - Plant sequence entries (including fungi and algae), part 2832. 5557. gbpln2833.seq - Plant sequence entries (including fungi and algae), part 2833. 5558. gbpln2834.seq - Plant sequence entries (including fungi and algae), part 2834. 5559. gbpln2835.seq - Plant sequence entries (including fungi and algae), part 2835. 5560. gbpln2836.seq - Plant sequence entries (including fungi and algae), part 2836. 5561. gbpln2837.seq - Plant sequence entries (including fungi and algae), part 2837. 5562. gbpln2838.seq - Plant sequence entries (including fungi and algae), part 2838. 5563. gbpln2839.seq - Plant sequence entries (including fungi and algae), part 2839. 5564. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284. 5565. gbpln2840.seq - Plant sequence entries (including fungi and algae), part 2840. 5566. gbpln2841.seq - Plant sequence entries (including fungi and algae), part 2841. 5567. gbpln2842.seq - Plant sequence entries (including fungi and algae), part 2842. 5568. gbpln2843.seq - Plant sequence entries (including fungi and algae), part 2843. 5569. gbpln2844.seq - Plant sequence entries (including fungi and algae), part 2844. 5570. gbpln2845.seq - Plant sequence entries (including fungi and algae), part 2845. 5571. gbpln2846.seq - Plant sequence entries (including fungi and algae), part 2846. 5572. gbpln2847.seq - Plant sequence entries (including fungi and algae), part 2847. 5573. gbpln2848.seq - Plant sequence entries (including fungi and algae), part 2848. 5574. gbpln2849.seq - Plant sequence entries (including fungi and algae), part 2849. 5575. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285. 5576. gbpln2850.seq - Plant sequence entries (including fungi and algae), part 2850. 5577. gbpln2851.seq - Plant sequence entries (including fungi and algae), part 2851. 5578. gbpln2852.seq - Plant sequence entries (including fungi and algae), part 2852. 5579. gbpln2853.seq - Plant sequence entries (including fungi and algae), part 2853. 5580. gbpln2854.seq - Plant sequence entries (including fungi and algae), part 2854. 5581. gbpln2855.seq - Plant sequence entries (including fungi and algae), part 2855. 5582. gbpln2856.seq - Plant sequence entries (including fungi and algae), part 2856. 5583. gbpln2857.seq - Plant sequence entries (including fungi and algae), part 2857. 5584. gbpln2858.seq - Plant sequence entries (including fungi and algae), part 2858. 5585. gbpln2859.seq - Plant sequence entries (including fungi and algae), part 2859. 5586. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286. 5587. gbpln2860.seq - Plant sequence entries (including fungi and algae), part 2860. 5588. gbpln2861.seq - Plant sequence entries (including fungi and algae), part 2861. 5589. gbpln2862.seq - Plant sequence entries (including fungi and algae), part 2862. 5590. gbpln2863.seq - Plant sequence entries (including fungi and algae), part 2863. 5591. gbpln2864.seq - Plant sequence entries (including fungi and algae), part 2864. 5592. gbpln2865.seq - Plant sequence entries (including fungi and algae), part 2865. 5593. gbpln2866.seq - Plant sequence entries (including fungi and algae), part 2866. 5594. gbpln2867.seq - Plant sequence entries (including fungi and algae), part 2867. 5595. gbpln2868.seq - Plant sequence entries (including fungi and algae), part 2868. 5596. gbpln2869.seq - Plant sequence entries (including fungi and algae), part 2869. 5597. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287. 5598. gbpln2870.seq - Plant sequence entries (including fungi and algae), part 2870. 5599. gbpln2871.seq - Plant sequence entries (including fungi and algae), part 2871. 5600. gbpln2872.seq - Plant sequence entries (including fungi and algae), part 2872. 5601. gbpln2873.seq - Plant sequence entries (including fungi and algae), part 2873. 5602. gbpln2874.seq - Plant sequence entries (including fungi and algae), part 2874. 5603. gbpln2875.seq - Plant sequence entries (including fungi and algae), part 2875. 5604. gbpln2876.seq - Plant sequence entries (including fungi and algae), part 2876. 5605. gbpln2877.seq - Plant sequence entries (including fungi and algae), part 2877. 5606. gbpln2878.seq - Plant sequence entries (including fungi and algae), part 2878. 5607. gbpln2879.seq - Plant sequence entries (including fungi and algae), part 2879. 5608. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288. 5609. gbpln2880.seq - Plant sequence entries (including fungi and algae), part 2880. 5610. gbpln2881.seq - Plant sequence entries (including fungi and algae), part 2881. 5611. gbpln2882.seq - Plant sequence entries (including fungi and algae), part 2882. 5612. gbpln2883.seq - Plant sequence entries (including fungi and algae), part 2883. 5613. gbpln2884.seq - Plant sequence entries (including fungi and algae), part 2884. 5614. gbpln2885.seq - Plant sequence entries (including fungi and algae), part 2885. 5615. gbpln2886.seq - Plant sequence entries (including fungi and algae), part 2886. 5616. gbpln2887.seq - Plant sequence entries (including fungi and algae), part 2887. 5617. gbpln2888.seq - Plant sequence entries (including fungi and algae), part 2888. 5618. gbpln2889.seq - Plant sequence entries (including fungi and algae), part 2889. 5619. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289. 5620. gbpln2890.seq - Plant sequence entries (including fungi and algae), part 2890. 5621. gbpln2891.seq - Plant sequence entries (including fungi and algae), part 2891. 5622. gbpln2892.seq - Plant sequence entries (including fungi and algae), part 2892. 5623. gbpln2893.seq - Plant sequence entries (including fungi and algae), part 2893. 5624. gbpln2894.seq - Plant sequence entries (including fungi and algae), part 2894. 5625. gbpln2895.seq - Plant sequence entries (including fungi and algae), part 2895. 5626. gbpln2896.seq - Plant sequence entries (including fungi and algae), part 2896. 5627. gbpln2897.seq - Plant sequence entries (including fungi and algae), part 2897. 5628. gbpln2898.seq - Plant sequence entries (including fungi and algae), part 2898. 5629. gbpln2899.seq - Plant sequence entries (including fungi and algae), part 2899. 5630. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29. 5631. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290. 5632. gbpln2900.seq - Plant sequence entries (including fungi and algae), part 2900. 5633. gbpln2901.seq - Plant sequence entries (including fungi and algae), part 2901. 5634. gbpln2902.seq - Plant sequence entries (including fungi and algae), part 2902. 5635. gbpln2903.seq - Plant sequence entries (including fungi and algae), part 2903. 5636. gbpln2904.seq - Plant sequence entries (including fungi and algae), part 2904. 5637. gbpln2905.seq - Plant sequence entries (including fungi and algae), part 2905. 5638. gbpln2906.seq - Plant sequence entries (including fungi and algae), part 2906. 5639. gbpln2907.seq - Plant sequence entries (including fungi and algae), part 2907. 5640. gbpln2908.seq - Plant sequence entries (including fungi and algae), part 2908. 5641. gbpln2909.seq - Plant sequence entries (including fungi and algae), part 2909. 5642. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291. 5643. gbpln2910.seq - Plant sequence entries (including fungi and algae), part 2910. 5644. gbpln2911.seq - Plant sequence entries (including fungi and algae), part 2911. 5645. gbpln2912.seq - Plant sequence entries (including fungi and algae), part 2912. 5646. gbpln2913.seq - Plant sequence entries (including fungi and algae), part 2913. 5647. gbpln2914.seq - Plant sequence entries (including fungi and algae), part 2914. 5648. gbpln2915.seq - Plant sequence entries (including fungi and algae), part 2915. 5649. gbpln2916.seq - Plant sequence entries (including fungi and algae), part 2916. 5650. gbpln2917.seq - Plant sequence entries (including fungi and algae), part 2917. 5651. gbpln2918.seq - Plant sequence entries (including fungi and algae), part 2918. 5652. gbpln2919.seq - Plant sequence entries (including fungi and algae), part 2919. 5653. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292. 5654. gbpln2920.seq - Plant sequence entries (including fungi and algae), part 2920. 5655. gbpln2921.seq - Plant sequence entries (including fungi and algae), part 2921. 5656. gbpln2922.seq - Plant sequence entries (including fungi and algae), part 2922. 5657. gbpln2923.seq - Plant sequence entries (including fungi and algae), part 2923. 5658. gbpln2924.seq - Plant sequence entries (including fungi and algae), part 2924. 5659. gbpln2925.seq - Plant sequence entries (including fungi and algae), part 2925. 5660. gbpln2926.seq - Plant sequence entries (including fungi and algae), part 2926. 5661. gbpln2927.seq - Plant sequence entries (including fungi and algae), part 2927. 5662. gbpln2928.seq - Plant sequence entries (including fungi and algae), part 2928. 5663. gbpln2929.seq - Plant sequence entries (including fungi and algae), part 2929. 5664. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293. 5665. gbpln2930.seq - Plant sequence entries (including fungi and algae), part 2930. 5666. gbpln2931.seq - Plant sequence entries (including fungi and algae), part 2931. 5667. gbpln2932.seq - Plant sequence entries (including fungi and algae), part 2932. 5668. gbpln2933.seq - Plant sequence entries (including fungi and algae), part 2933. 5669. gbpln2934.seq - Plant sequence entries (including fungi and algae), part 2934. 5670. gbpln2935.seq - Plant sequence entries (including fungi and algae), part 2935. 5671. gbpln2936.seq - Plant sequence entries (including fungi and algae), part 2936. 5672. gbpln2937.seq - Plant sequence entries (including fungi and algae), part 2937. 5673. gbpln2938.seq - Plant sequence entries (including fungi and algae), part 2938. 5674. gbpln2939.seq - Plant sequence entries (including fungi and algae), part 2939. 5675. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294. 5676. gbpln2940.seq - Plant sequence entries (including fungi and algae), part 2940. 5677. gbpln2941.seq - Plant sequence entries (including fungi and algae), part 2941. 5678. gbpln2942.seq - Plant sequence entries (including fungi and algae), part 2942. 5679. gbpln2943.seq - Plant sequence entries (including fungi and algae), part 2943. 5680. gbpln2944.seq - Plant sequence entries (including fungi and algae), part 2944. 5681. gbpln2945.seq - Plant sequence entries (including fungi and algae), part 2945. 5682. gbpln2946.seq - Plant sequence entries (including fungi and algae), part 2946. 5683. gbpln2947.seq - Plant sequence entries (including fungi and algae), part 2947. 5684. gbpln2948.seq - Plant sequence entries (including fungi and algae), part 2948. 5685. gbpln2949.seq - Plant sequence entries (including fungi and algae), part 2949. 5686. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295. 5687. gbpln2950.seq - Plant sequence entries (including fungi and algae), part 2950. 5688. gbpln2951.seq - Plant sequence entries (including fungi and algae), part 2951. 5689. gbpln2952.seq - Plant sequence entries (including fungi and algae), part 2952. 5690. gbpln2953.seq - Plant sequence entries (including fungi and algae), part 2953. 5691. gbpln2954.seq - Plant sequence entries (including fungi and algae), part 2954. 5692. gbpln2955.seq - Plant sequence entries (including fungi and algae), part 2955. 5693. gbpln2956.seq - Plant sequence entries (including fungi and algae), part 2956. 5694. gbpln2957.seq - Plant sequence entries (including fungi and algae), part 2957. 5695. gbpln2958.seq - Plant sequence entries (including fungi and algae), part 2958. 5696. gbpln2959.seq - Plant sequence entries (including fungi and algae), part 2959. 5697. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296. 5698. gbpln2960.seq - Plant sequence entries (including fungi and algae), part 2960. 5699. gbpln2961.seq - Plant sequence entries (including fungi and algae), part 2961. 5700. gbpln2962.seq - Plant sequence entries (including fungi and algae), part 2962. 5701. gbpln2963.seq - Plant sequence entries (including fungi and algae), part 2963. 5702. gbpln2964.seq - Plant sequence entries (including fungi and algae), part 2964. 5703. gbpln2965.seq - Plant sequence entries (including fungi and algae), part 2965. 5704. gbpln2966.seq - Plant sequence entries (including fungi and algae), part 2966. 5705. gbpln2967.seq - Plant sequence entries (including fungi and algae), part 2967. 5706. gbpln2968.seq - Plant sequence entries (including fungi and algae), part 2968. 5707. gbpln2969.seq - Plant sequence entries (including fungi and algae), part 2969. 5708. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297. 5709. gbpln2970.seq - Plant sequence entries (including fungi and algae), part 2970. 5710. gbpln2971.seq - Plant sequence entries (including fungi and algae), part 2971. 5711. gbpln2972.seq - Plant sequence entries (including fungi and algae), part 2972. 5712. gbpln2973.seq - Plant sequence entries (including fungi and algae), part 2973. 5713. gbpln2974.seq - Plant sequence entries (including fungi and algae), part 2974. 5714. gbpln2975.seq - Plant sequence entries (including fungi and algae), part 2975. 5715. gbpln2976.seq - Plant sequence entries (including fungi and algae), part 2976. 5716. gbpln2977.seq - Plant sequence entries (including fungi and algae), part 2977. 5717. gbpln2978.seq - Plant sequence entries (including fungi and algae), part 2978. 5718. gbpln2979.seq - Plant sequence entries (including fungi and algae), part 2979. 5719. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298. 5720. gbpln2980.seq - Plant sequence entries (including fungi and algae), part 2980. 5721. gbpln2981.seq - Plant sequence entries (including fungi and algae), part 2981. 5722. gbpln2982.seq - Plant sequence entries (including fungi and algae), part 2982. 5723. gbpln2983.seq - Plant sequence entries (including fungi and algae), part 2983. 5724. gbpln2984.seq - Plant sequence entries (including fungi and algae), part 2984. 5725. gbpln2985.seq - Plant sequence entries (including fungi and algae), part 2985. 5726. gbpln2986.seq - Plant sequence entries (including fungi and algae), part 2986. 5727. gbpln2987.seq - Plant sequence entries (including fungi and algae), part 2987. 5728. gbpln2988.seq - Plant sequence entries (including fungi and algae), part 2988. 5729. gbpln2989.seq - Plant sequence entries (including fungi and algae), part 2989. 5730. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299. 5731. gbpln2990.seq - Plant sequence entries (including fungi and algae), part 2990. 5732. gbpln2991.seq - Plant sequence entries (including fungi and algae), part 2991. 5733. gbpln2992.seq - Plant sequence entries (including fungi and algae), part 2992. 5734. gbpln2993.seq - Plant sequence entries (including fungi and algae), part 2993. 5735. gbpln2994.seq - Plant sequence entries (including fungi and algae), part 2994. 5736. gbpln2995.seq - Plant sequence entries (including fungi and algae), part 2995. 5737. gbpln2996.seq - Plant sequence entries (including fungi and algae), part 2996. 5738. gbpln2997.seq - Plant sequence entries (including fungi and algae), part 2997. 5739. gbpln2998.seq - Plant sequence entries (including fungi and algae), part 2998. 5740. gbpln2999.seq - Plant sequence entries (including fungi and algae), part 2999. 5741. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3. 5742. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30. 5743. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300. 5744. gbpln3000.seq - Plant sequence entries (including fungi and algae), part 3000. 5745. gbpln3001.seq - Plant sequence entries (including fungi and algae), part 3001. 5746. gbpln3002.seq - Plant sequence entries (including fungi and algae), part 3002. 5747. gbpln3003.seq - Plant sequence entries (including fungi and algae), part 3003. 5748. gbpln3004.seq - Plant sequence entries (including fungi and algae), part 3004. 5749. gbpln3005.seq - Plant sequence entries (including fungi and algae), part 3005. 5750. gbpln3006.seq - Plant sequence entries (including fungi and algae), part 3006. 5751. gbpln3007.seq - Plant sequence entries (including fungi and algae), part 3007. 5752. gbpln3008.seq - Plant sequence entries (including fungi and algae), part 3008. 5753. gbpln3009.seq - Plant sequence entries (including fungi and algae), part 3009. 5754. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301. 5755. gbpln3010.seq - Plant sequence entries (including fungi and algae), part 3010. 5756. gbpln3011.seq - Plant sequence entries (including fungi and algae), part 3011. 5757. gbpln3012.seq - Plant sequence entries (including fungi and algae), part 3012. 5758. gbpln3013.seq - Plant sequence entries (including fungi and algae), part 3013. 5759. gbpln3014.seq - Plant sequence entries (including fungi and algae), part 3014. 5760. gbpln3015.seq - Plant sequence entries (including fungi and algae), part 3015. 5761. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302. 5762. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303. 5763. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304. 5764. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305. 5765. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306. 5766. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307. 5767. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308. 5768. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309. 5769. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31. 5770. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310. 5771. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311. 5772. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312. 5773. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313. 5774. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314. 5775. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315. 5776. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316. 5777. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317. 5778. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318. 5779. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319. 5780. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32. 5781. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320. 5782. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321. 5783. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322. 5784. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323. 5785. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324. 5786. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325. 5787. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326. 5788. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327. 5789. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328. 5790. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329. 5791. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33. 5792. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330. 5793. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331. 5794. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332. 5795. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333. 5796. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334. 5797. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335. 5798. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336. 5799. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337. 5800. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338. 5801. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339. 5802. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34. 5803. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340. 5804. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341. 5805. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342. 5806. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343. 5807. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344. 5808. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345. 5809. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346. 5810. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347. 5811. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348. 5812. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349. 5813. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35. 5814. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350. 5815. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351. 5816. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352. 5817. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353. 5818. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354. 5819. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355. 5820. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356. 5821. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357. 5822. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358. 5823. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359. 5824. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36. 5825. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360. 5826. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361. 5827. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362. 5828. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363. 5829. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364. 5830. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365. 5831. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366. 5832. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367. 5833. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368. 5834. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369. 5835. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37. 5836. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370. 5837. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371. 5838. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372. 5839. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373. 5840. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374. 5841. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375. 5842. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376. 5843. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377. 5844. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378. 5845. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379. 5846. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38. 5847. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380. 5848. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381. 5849. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382. 5850. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383. 5851. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384. 5852. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385. 5853. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386. 5854. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387. 5855. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388. 5856. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389. 5857. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39. 5858. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390. 5859. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391. 5860. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392. 5861. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393. 5862. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394. 5863. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395. 5864. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396. 5865. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397. 5866. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398. 5867. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399. 5868. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4. 5869. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40. 5870. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400. 5871. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401. 5872. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402. 5873. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403. 5874. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404. 5875. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405. 5876. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406. 5877. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407. 5878. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408. 5879. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409. 5880. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41. 5881. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410. 5882. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411. 5883. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412. 5884. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413. 5885. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414. 5886. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415. 5887. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416. 5888. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417. 5889. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418. 5890. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419. 5891. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42. 5892. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420. 5893. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421. 5894. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422. 5895. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423. 5896. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424. 5897. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425. 5898. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426. 5899. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427. 5900. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428. 5901. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429. 5902. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43. 5903. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430. 5904. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431. 5905. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432. 5906. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433. 5907. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434. 5908. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435. 5909. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436. 5910. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437. 5911. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438. 5912. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439. 5913. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44. 5914. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440. 5915. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441. 5916. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442. 5917. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443. 5918. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444. 5919. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445. 5920. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446. 5921. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447. 5922. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448. 5923. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449. 5924. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45. 5925. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450. 5926. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451. 5927. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452. 5928. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453. 5929. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454. 5930. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455. 5931. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456. 5932. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457. 5933. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458. 5934. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459. 5935. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46. 5936. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460. 5937. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461. 5938. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462. 5939. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463. 5940. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464. 5941. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465. 5942. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466. 5943. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467. 5944. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468. 5945. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469. 5946. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47. 5947. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470. 5948. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471. 5949. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472. 5950. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473. 5951. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474. 5952. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475. 5953. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476. 5954. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477. 5955. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478. 5956. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479. 5957. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48. 5958. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480. 5959. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481. 5960. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482. 5961. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483. 5962. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484. 5963. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485. 5964. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486. 5965. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487. 5966. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488. 5967. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489. 5968. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49. 5969. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490. 5970. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491. 5971. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492. 5972. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493. 5973. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494. 5974. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495. 5975. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496. 5976. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497. 5977. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498. 5978. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499. 5979. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5. 5980. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50. 5981. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500. 5982. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501. 5983. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502. 5984. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503. 5985. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504. 5986. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505. 5987. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506. 5988. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507. 5989. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508. 5990. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509. 5991. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51. 5992. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510. 5993. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511. 5994. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512. 5995. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513. 5996. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514. 5997. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515. 5998. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516. 5999. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517. 6000. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518. 6001. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519. 6002. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52. 6003. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520. 6004. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521. 6005. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522. 6006. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523. 6007. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524. 6008. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525. 6009. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526. 6010. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527. 6011. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528. 6012. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529. 6013. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53. 6014. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530. 6015. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531. 6016. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532. 6017. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533. 6018. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534. 6019. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535. 6020. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536. 6021. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537. 6022. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538. 6023. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539. 6024. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54. 6025. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540. 6026. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541. 6027. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542. 6028. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543. 6029. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544. 6030. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545. 6031. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546. 6032. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547. 6033. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548. 6034. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549. 6035. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55. 6036. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550. 6037. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551. 6038. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552. 6039. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553. 6040. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554. 6041. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555. 6042. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556. 6043. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557. 6044. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558. 6045. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559. 6046. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56. 6047. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560. 6048. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561. 6049. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562. 6050. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563. 6051. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564. 6052. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565. 6053. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566. 6054. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567. 6055. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568. 6056. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569. 6057. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57. 6058. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570. 6059. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571. 6060. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572. 6061. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573. 6062. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574. 6063. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575. 6064. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576. 6065. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577. 6066. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578. 6067. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579. 6068. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58. 6069. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580. 6070. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581. 6071. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582. 6072. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583. 6073. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584. 6074. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585. 6075. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586. 6076. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587. 6077. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588. 6078. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589. 6079. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59. 6080. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590. 6081. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591. 6082. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592. 6083. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593. 6084. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594. 6085. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595. 6086. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596. 6087. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597. 6088. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598. 6089. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599. 6090. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6. 6091. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60. 6092. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600. 6093. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601. 6094. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602. 6095. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603. 6096. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604. 6097. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605. 6098. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606. 6099. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607. 6100. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608. 6101. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609. 6102. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61. 6103. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610. 6104. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611. 6105. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612. 6106. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613. 6107. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614. 6108. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615. 6109. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616. 6110. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617. 6111. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618. 6112. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619. 6113. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62. 6114. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620. 6115. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621. 6116. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622. 6117. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623. 6118. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624. 6119. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625. 6120. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626. 6121. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627. 6122. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628. 6123. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629. 6124. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63. 6125. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630. 6126. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631. 6127. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632. 6128. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633. 6129. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634. 6130. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635. 6131. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636. 6132. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637. 6133. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638. 6134. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639. 6135. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64. 6136. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640. 6137. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641. 6138. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642. 6139. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643. 6140. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644. 6141. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645. 6142. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646. 6143. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647. 6144. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648. 6145. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649. 6146. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65. 6147. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650. 6148. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651. 6149. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652. 6150. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653. 6151. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654. 6152. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655. 6153. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656. 6154. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657. 6155. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658. 6156. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659. 6157. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66. 6158. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660. 6159. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661. 6160. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662. 6161. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663. 6162. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664. 6163. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665. 6164. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666. 6165. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667. 6166. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668. 6167. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669. 6168. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67. 6169. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670. 6170. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671. 6171. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672. 6172. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673. 6173. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674. 6174. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675. 6175. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676. 6176. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677. 6177. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678. 6178. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679. 6179. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68. 6180. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680. 6181. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681. 6182. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682. 6183. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683. 6184. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684. 6185. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685. 6186. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686. 6187. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687. 6188. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688. 6189. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689. 6190. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69. 6191. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690. 6192. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691. 6193. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692. 6194. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693. 6195. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694. 6196. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695. 6197. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696. 6198. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697. 6199. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698. 6200. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699. 6201. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7. 6202. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70. 6203. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700. 6204. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701. 6205. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702. 6206. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703. 6207. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704. 6208. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705. 6209. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706. 6210. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707. 6211. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708. 6212. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709. 6213. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71. 6214. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710. 6215. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711. 6216. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712. 6217. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713. 6218. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714. 6219. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715. 6220. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716. 6221. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717. 6222. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718. 6223. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719. 6224. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72. 6225. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720. 6226. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721. 6227. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722. 6228. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723. 6229. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724. 6230. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725. 6231. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726. 6232. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727. 6233. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728. 6234. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729. 6235. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73. 6236. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730. 6237. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731. 6238. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732. 6239. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733. 6240. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734. 6241. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735. 6242. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736. 6243. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737. 6244. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738. 6245. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739. 6246. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74. 6247. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740. 6248. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741. 6249. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742. 6250. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743. 6251. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744. 6252. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745. 6253. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746. 6254. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747. 6255. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748. 6256. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749. 6257. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75. 6258. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750. 6259. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751. 6260. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752. 6261. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753. 6262. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754. 6263. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755. 6264. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756. 6265. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757. 6266. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758. 6267. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759. 6268. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76. 6269. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760. 6270. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761. 6271. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762. 6272. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763. 6273. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764. 6274. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765. 6275. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766. 6276. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767. 6277. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768. 6278. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769. 6279. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77. 6280. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770. 6281. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771. 6282. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772. 6283. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773. 6284. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774. 6285. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775. 6286. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776. 6287. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777. 6288. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778. 6289. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779. 6290. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78. 6291. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780. 6292. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781. 6293. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782. 6294. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783. 6295. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784. 6296. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785. 6297. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786. 6298. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787. 6299. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788. 6300. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789. 6301. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79. 6302. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790. 6303. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791. 6304. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792. 6305. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793. 6306. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794. 6307. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795. 6308. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796. 6309. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797. 6310. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798. 6311. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799. 6312. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8. 6313. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80. 6314. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800. 6315. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801. 6316. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802. 6317. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803. 6318. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804. 6319. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805. 6320. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806. 6321. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807. 6322. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808. 6323. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809. 6324. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81. 6325. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810. 6326. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811. 6327. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812. 6328. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813. 6329. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814. 6330. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815. 6331. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816. 6332. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817. 6333. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818. 6334. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819. 6335. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82. 6336. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820. 6337. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821. 6338. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822. 6339. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823. 6340. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824. 6341. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825. 6342. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826. 6343. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827. 6344. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828. 6345. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829. 6346. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83. 6347. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830. 6348. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831. 6349. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832. 6350. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833. 6351. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834. 6352. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835. 6353. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836. 6354. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837. 6355. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838. 6356. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839. 6357. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84. 6358. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840. 6359. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841. 6360. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842. 6361. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843. 6362. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844. 6363. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845. 6364. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846. 6365. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847. 6366. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848. 6367. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849. 6368. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85. 6369. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850. 6370. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851. 6371. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852. 6372. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853. 6373. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854. 6374. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855. 6375. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856. 6376. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857. 6377. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858. 6378. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859. 6379. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86. 6380. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860. 6381. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861. 6382. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862. 6383. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863. 6384. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864. 6385. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865. 6386. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866. 6387. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867. 6388. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868. 6389. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869. 6390. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87. 6391. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870. 6392. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871. 6393. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872. 6394. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873. 6395. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874. 6396. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875. 6397. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876. 6398. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877. 6399. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878. 6400. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879. 6401. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88. 6402. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880. 6403. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881. 6404. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882. 6405. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883. 6406. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884. 6407. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885. 6408. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886. 6409. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887. 6410. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888. 6411. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889. 6412. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89. 6413. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890. 6414. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891. 6415. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892. 6416. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893. 6417. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894. 6418. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895. 6419. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896. 6420. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897. 6421. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898. 6422. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899. 6423. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9. 6424. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90. 6425. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900. 6426. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901. 6427. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902. 6428. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903. 6429. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904. 6430. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905. 6431. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906. 6432. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907. 6433. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908. 6434. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909. 6435. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91. 6436. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910. 6437. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911. 6438. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912. 6439. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913. 6440. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914. 6441. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915. 6442. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916. 6443. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917. 6444. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918. 6445. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919. 6446. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92. 6447. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920. 6448. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921. 6449. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922. 6450. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923. 6451. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924. 6452. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925. 6453. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926. 6454. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927. 6455. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928. 6456. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929. 6457. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93. 6458. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930. 6459. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931. 6460. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932. 6461. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933. 6462. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934. 6463. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935. 6464. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936. 6465. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937. 6466. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938. 6467. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939. 6468. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94. 6469. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940. 6470. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941. 6471. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942. 6472. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943. 6473. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944. 6474. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945. 6475. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946. 6476. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947. 6477. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948. 6478. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949. 6479. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95. 6480. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950. 6481. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951. 6482. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952. 6483. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953. 6484. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954. 6485. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955. 6486. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956. 6487. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957. 6488. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958. 6489. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959. 6490. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96. 6491. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960. 6492. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961. 6493. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962. 6494. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963. 6495. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964. 6496. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965. 6497. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966. 6498. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967. 6499. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968. 6500. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969. 6501. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97. 6502. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970. 6503. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971. 6504. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972. 6505. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973. 6506. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974. 6507. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975. 6508. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976. 6509. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977. 6510. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978. 6511. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979. 6512. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98. 6513. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980. 6514. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981. 6515. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982. 6516. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983. 6517. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984. 6518. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985. 6519. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986. 6520. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987. 6521. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988. 6522. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989. 6523. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99. 6524. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990. 6525. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991. 6526. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992. 6527. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993. 6528. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994. 6529. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995. 6530. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996. 6531. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997. 6532. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998. 6533. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999. 6534. gbpri1.seq - Primate sequence entries, part 1. 6535. gbpri10.seq - Primate sequence entries, part 10. 6536. gbpri11.seq - Primate sequence entries, part 11. 6537. gbpri12.seq - Primate sequence entries, part 12. 6538. gbpri13.seq - Primate sequence entries, part 13. 6539. gbpri14.seq - Primate sequence entries, part 14. 6540. gbpri15.seq - Primate sequence entries, part 15. 6541. gbpri16.seq - Primate sequence entries, part 16. 6542. gbpri17.seq - Primate sequence entries, part 17. 6543. gbpri18.seq - Primate sequence entries, part 18. 6544. gbpri19.seq - Primate sequence entries, part 19. 6545. gbpri2.seq - Primate sequence entries, part 2. 6546. gbpri20.seq - Primate sequence entries, part 20. 6547. gbpri21.seq - Primate sequence entries, part 21. 6548. gbpri22.seq - Primate sequence entries, part 22. 6549. gbpri23.seq - Primate sequence entries, part 23. 6550. gbpri24.seq - Primate sequence entries, part 24. 6551. gbpri25.seq - Primate sequence entries, part 25. 6552. gbpri26.seq - Primate sequence entries, part 26. 6553. gbpri27.seq - Primate sequence entries, part 27. 6554. gbpri28.seq - Primate sequence entries, part 28. 6555. gbpri3.seq - Primate sequence entries, part 3. 6556. gbpri4.seq - Primate sequence entries, part 4. 6557. gbpri5.seq - Primate sequence entries, part 5. 6558. gbpri6.seq - Primate sequence entries, part 6. 6559. gbpri7.seq - Primate sequence entries, part 7. 6560. gbpri8.seq - Primate sequence entries, part 8. 6561. gbpri9.seq - Primate sequence entries, part 9. 6562. gbrel.txt - Release notes (this document). 6563. gbrod1.seq - Rodent sequence entries, part 1. 6564. gbrod10.seq - Rodent sequence entries, part 10. 6565. gbrod100.seq - Rodent sequence entries, part 100. 6566. gbrod101.seq - Rodent sequence entries, part 101. 6567. gbrod102.seq - Rodent sequence entries, part 102. 6568. gbrod103.seq - Rodent sequence entries, part 103. 6569. gbrod104.seq - Rodent sequence entries, part 104. 6570. gbrod105.seq - Rodent sequence entries, part 105. 6571. gbrod106.seq - Rodent sequence entries, part 106. 6572. gbrod107.seq - Rodent sequence entries, part 107. 6573. gbrod108.seq - Rodent sequence entries, part 108. 6574. gbrod109.seq - Rodent sequence entries, part 109. 6575. gbrod11.seq - Rodent sequence entries, part 11. 6576. gbrod110.seq - Rodent sequence entries, part 110. 6577. gbrod111.seq - Rodent sequence entries, part 111. 6578. gbrod112.seq - Rodent sequence entries, part 112. 6579. gbrod113.seq - Rodent sequence entries, part 113. 6580. gbrod114.seq - Rodent sequence entries, part 114. 6581. gbrod115.seq - Rodent sequence entries, part 115. 6582. gbrod116.seq - Rodent sequence entries, part 116. 6583. gbrod117.seq - Rodent sequence entries, part 117. 6584. gbrod118.seq - Rodent sequence entries, part 118. 6585. gbrod119.seq - Rodent sequence entries, part 119. 6586. gbrod12.seq - Rodent sequence entries, part 12. 6587. gbrod120.seq - Rodent sequence entries, part 120. 6588. gbrod121.seq - Rodent sequence entries, part 121. 6589. gbrod122.seq - Rodent sequence entries, part 122. 6590. gbrod123.seq - Rodent sequence entries, part 123. 6591. gbrod124.seq - Rodent sequence entries, part 124. 6592. gbrod125.seq - Rodent sequence entries, part 125. 6593. gbrod126.seq - Rodent sequence entries, part 126. 6594. gbrod127.seq - Rodent sequence entries, part 127. 6595. gbrod13.seq - Rodent sequence entries, part 13. 6596. gbrod14.seq - Rodent sequence entries, part 14. 6597. gbrod15.seq - Rodent sequence entries, part 15. 6598. gbrod16.seq - Rodent sequence entries, part 16. 6599. gbrod17.seq - Rodent sequence entries, part 17. 6600. gbrod18.seq - Rodent sequence entries, part 18. 6601. gbrod19.seq - Rodent sequence entries, part 19. 6602. gbrod2.seq - Rodent sequence entries, part 2. 6603. gbrod20.seq - Rodent sequence entries, part 20. 6604. gbrod21.seq - Rodent sequence entries, part 21. 6605. gbrod22.seq - Rodent sequence entries, part 22. 6606. gbrod23.seq - Rodent sequence entries, part 23. 6607. gbrod24.seq - Rodent sequence entries, part 24. 6608. gbrod25.seq - Rodent sequence entries, part 25. 6609. gbrod26.seq - Rodent sequence entries, part 26. 6610. gbrod27.seq - Rodent sequence entries, part 27. 6611. gbrod28.seq - Rodent sequence entries, part 28. 6612. gbrod29.seq - Rodent sequence entries, part 29. 6613. gbrod3.seq - Rodent sequence entries, part 3. 6614. gbrod30.seq - Rodent sequence entries, part 30. 6615. gbrod31.seq - Rodent sequence entries, part 31. 6616. gbrod32.seq - Rodent sequence entries, part 32. 6617. gbrod33.seq - Rodent sequence entries, part 33. 6618. gbrod34.seq - Rodent sequence entries, part 34. 6619. gbrod35.seq - Rodent sequence entries, part 35. 6620. gbrod36.seq - Rodent sequence entries, part 36. 6621. gbrod37.seq - Rodent sequence entries, part 37. 6622. gbrod38.seq - Rodent sequence entries, part 38. 6623. gbrod39.seq - Rodent sequence entries, part 39. 6624. gbrod4.seq - Rodent sequence entries, part 4. 6625. gbrod40.seq - Rodent sequence entries, part 40. 6626. gbrod41.seq - Rodent sequence entries, part 41. 6627. gbrod42.seq - Rodent sequence entries, part 42. 6628. gbrod43.seq - Rodent sequence entries, part 43. 6629. gbrod44.seq - Rodent sequence entries, part 44. 6630. gbrod45.seq - Rodent sequence entries, part 45. 6631. gbrod46.seq - Rodent sequence entries, part 46. 6632. gbrod47.seq - Rodent sequence entries, part 47. 6633. gbrod48.seq - Rodent sequence entries, part 48. 6634. gbrod49.seq - Rodent sequence entries, part 49. 6635. gbrod5.seq - Rodent sequence entries, part 5. 6636. gbrod50.seq - Rodent sequence entries, part 50. 6637. gbrod51.seq - Rodent sequence entries, part 51. 6638. gbrod52.seq - Rodent sequence entries, part 52. 6639. gbrod53.seq - Rodent sequence entries, part 53. 6640. gbrod54.seq - Rodent sequence entries, part 54. 6641. gbrod55.seq - Rodent sequence entries, part 55. 6642. gbrod56.seq - Rodent sequence entries, part 56. 6643. gbrod57.seq - Rodent sequence entries, part 57. 6644. gbrod58.seq - Rodent sequence entries, part 58. 6645. gbrod59.seq - Rodent sequence entries, part 59. 6646. gbrod6.seq - Rodent sequence entries, part 6. 6647. gbrod60.seq - Rodent sequence entries, part 60. 6648. gbrod61.seq - Rodent sequence entries, part 61. 6649. gbrod62.seq - Rodent sequence entries, part 62. 6650. gbrod63.seq - Rodent sequence entries, part 63. 6651. gbrod64.seq - Rodent sequence entries, part 64. 6652. gbrod65.seq - Rodent sequence entries, part 65. 6653. gbrod66.seq - Rodent sequence entries, part 66. 6654. gbrod67.seq - Rodent sequence entries, part 67. 6655. gbrod68.seq - Rodent sequence entries, part 68. 6656. gbrod69.seq - Rodent sequence entries, part 69. 6657. gbrod7.seq - Rodent sequence entries, part 7. 6658. gbrod70.seq - Rodent sequence entries, part 70. 6659. gbrod71.seq - Rodent sequence entries, part 71. 6660. gbrod72.seq - Rodent sequence entries, part 72. 6661. gbrod73.seq - Rodent sequence entries, part 73. 6662. gbrod74.seq - Rodent sequence entries, part 74. 6663. gbrod75.seq - Rodent sequence entries, part 75. 6664. gbrod76.seq - Rodent sequence entries, part 76. 6665. gbrod77.seq - Rodent sequence entries, part 77. 6666. gbrod78.seq - Rodent sequence entries, part 78. 6667. gbrod79.seq - Rodent sequence entries, part 79. 6668. gbrod8.seq - Rodent sequence entries, part 8. 6669. gbrod80.seq - Rodent sequence entries, part 80. 6670. gbrod81.seq - Rodent sequence entries, part 81. 6671. gbrod82.seq - Rodent sequence entries, part 82. 6672. gbrod83.seq - Rodent sequence entries, part 83. 6673. gbrod84.seq - Rodent sequence entries, part 84. 6674. gbrod85.seq - Rodent sequence entries, part 85. 6675. gbrod86.seq - Rodent sequence entries, part 86. 6676. gbrod87.seq - Rodent sequence entries, part 87. 6677. gbrod88.seq - Rodent sequence entries, part 88. 6678. gbrod89.seq - Rodent sequence entries, part 89. 6679. gbrod9.seq - Rodent sequence entries, part 9. 6680. gbrod90.seq - Rodent sequence entries, part 90. 6681. gbrod91.seq - Rodent sequence entries, part 91. 6682. gbrod92.seq - Rodent sequence entries, part 92. 6683. gbrod93.seq - Rodent sequence entries, part 93. 6684. gbrod94.seq - Rodent sequence entries, part 94. 6685. gbrod95.seq - Rodent sequence entries, part 95. 6686. gbrod96.seq - Rodent sequence entries, part 96. 6687. gbrod97.seq - Rodent sequence entries, part 97. 6688. gbrod98.seq - Rodent sequence entries, part 98. 6689. gbrod99.seq - Rodent sequence entries, part 99. 6690. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1. 6691. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2. 6692. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3. 6693. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1. 6694. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10. 6695. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2. 6696. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3. 6697. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4. 6698. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5. 6699. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6. 6700. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7. 6701. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8. 6702. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9. 6703. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1. 6704. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10. 6705. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11. 6706. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12. 6707. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13. 6708. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14. 6709. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15. 6710. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16. 6711. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17. 6712. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18. 6713. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19. 6714. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2. 6715. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20. 6716. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21. 6717. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22. 6718. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23. 6719. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24. 6720. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25. 6721. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26. 6722. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27. 6723. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28. 6724. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29. 6725. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3. 6726. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30. 6727. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31. 6728. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32. 6729. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33. 6730. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34. 6731. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35. 6732. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36. 6733. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37. 6734. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4. 6735. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5. 6736. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6. 6737. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7. 6738. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8. 6739. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9. 6740. gbuna1.seq - Unannotated sequence entries, part 1. 6741. gbvrl1.seq - Viral sequence entries, part 1. 6742. gbvrl10.seq - Viral sequence entries, part 10. 6743. gbvrl100.seq - Viral sequence entries, part 100. 6744. gbvrl101.seq - Viral sequence entries, part 101. 6745. gbvrl102.seq - Viral sequence entries, part 102. 6746. gbvrl103.seq - Viral sequence entries, part 103. 6747. gbvrl104.seq - Viral sequence entries, part 104. 6748. gbvrl105.seq - Viral sequence entries, part 105. 6749. gbvrl106.seq - Viral sequence entries, part 106. 6750. gbvrl107.seq - Viral sequence entries, part 107. 6751. gbvrl108.seq - Viral sequence entries, part 108. 6752. gbvrl109.seq - Viral sequence entries, part 109. 6753. gbvrl11.seq - Viral sequence entries, part 11. 6754. gbvrl110.seq - Viral sequence entries, part 110. 6755. gbvrl111.seq - Viral sequence entries, part 111. 6756. gbvrl112.seq - Viral sequence entries, part 112. 6757. gbvrl113.seq - Viral sequence entries, part 113. 6758. gbvrl114.seq - Viral sequence entries, part 114. 6759. gbvrl115.seq - Viral sequence entries, part 115. 6760. gbvrl116.seq - Viral sequence entries, part 116. 6761. gbvrl117.seq - Viral sequence entries, part 117. 6762. gbvrl118.seq - Viral sequence entries, part 118. 6763. gbvrl119.seq - Viral sequence entries, part 119. 6764. gbvrl12.seq - Viral sequence entries, part 12. 6765. gbvrl120.seq - Viral sequence entries, part 120. 6766. gbvrl121.seq - Viral sequence entries, part 121. 6767. gbvrl122.seq - Viral sequence entries, part 122. 6768. gbvrl123.seq - Viral sequence entries, part 123. 6769. gbvrl124.seq - Viral sequence entries, part 124. 6770. gbvrl125.seq - Viral sequence entries, part 125. 6771. gbvrl126.seq - Viral sequence entries, part 126. 6772. gbvrl127.seq - Viral sequence entries, part 127. 6773. gbvrl128.seq - Viral sequence entries, part 128. 6774. gbvrl129.seq - Viral sequence entries, part 129. 6775. gbvrl13.seq - Viral sequence entries, part 13. 6776. gbvrl130.seq - Viral sequence entries, part 130. 6777. gbvrl131.seq - Viral sequence entries, part 131. 6778. gbvrl132.seq - Viral sequence entries, part 132. 6779. gbvrl133.seq - Viral sequence entries, part 133. 6780. gbvrl134.seq - Viral sequence entries, part 134. 6781. gbvrl135.seq - Viral sequence entries, part 135. 6782. gbvrl136.seq - Viral sequence entries, part 136. 6783. gbvrl137.seq - Viral sequence entries, part 137. 6784. gbvrl138.seq - Viral sequence entries, part 138. 6785. gbvrl139.seq - Viral sequence entries, part 139. 6786. gbvrl14.seq - Viral sequence entries, part 14. 6787. gbvrl140.seq - Viral sequence entries, part 140. 6788. gbvrl141.seq - Viral sequence entries, part 141. 6789. gbvrl142.seq - Viral sequence entries, part 142. 6790. gbvrl143.seq - Viral sequence entries, part 143. 6791. gbvrl144.seq - Viral sequence entries, part 144. 6792. gbvrl145.seq - Viral sequence entries, part 145. 6793. gbvrl146.seq - Viral sequence entries, part 146. 6794. gbvrl147.seq - Viral sequence entries, part 147. 6795. gbvrl148.seq - Viral sequence entries, part 148. 6796. gbvrl149.seq - Viral sequence entries, part 149. 6797. gbvrl15.seq - Viral sequence entries, part 15. 6798. gbvrl150.seq - Viral sequence entries, part 150. 6799. gbvrl151.seq - Viral sequence entries, part 151. 6800. gbvrl152.seq - Viral sequence entries, part 152. 6801. gbvrl153.seq - Viral sequence entries, part 153. 6802. gbvrl154.seq - Viral sequence entries, part 154. 6803. gbvrl155.seq - Viral sequence entries, part 155. 6804. gbvrl156.seq - Viral sequence entries, part 156. 6805. gbvrl157.seq - Viral sequence entries, part 157. 6806. gbvrl158.seq - Viral sequence entries, part 158. 6807. gbvrl159.seq - Viral sequence entries, part 159. 6808. gbvrl16.seq - Viral sequence entries, part 16. 6809. gbvrl160.seq - Viral sequence entries, part 160. 6810. gbvrl161.seq - Viral sequence entries, part 161. 6811. gbvrl162.seq - Viral sequence entries, part 162. 6812. gbvrl163.seq - Viral sequence entries, part 163. 6813. gbvrl164.seq - Viral sequence entries, part 164. 6814. gbvrl165.seq - Viral sequence entries, part 165. 6815. gbvrl166.seq - Viral sequence entries, part 166. 6816. gbvrl167.seq - Viral sequence entries, part 167. 6817. gbvrl168.seq - Viral sequence entries, part 168. 6818. gbvrl169.seq - Viral sequence entries, part 169. 6819. gbvrl17.seq - Viral sequence entries, part 17. 6820. gbvrl170.seq - Viral sequence entries, part 170. 6821. gbvrl171.seq - Viral sequence entries, part 171. 6822. gbvrl172.seq - Viral sequence entries, part 172. 6823. gbvrl173.seq - Viral sequence entries, part 173. 6824. gbvrl174.seq - Viral sequence entries, part 174. 6825. gbvrl175.seq - Viral sequence entries, part 175. 6826. gbvrl176.seq - Viral sequence entries, part 176. 6827. gbvrl177.seq - Viral sequence entries, part 177. 6828. gbvrl178.seq - Viral sequence entries, part 178. 6829. gbvrl179.seq - Viral sequence entries, part 179. 6830. gbvrl18.seq - Viral sequence entries, part 18. 6831. gbvrl180.seq - Viral sequence entries, part 180. 6832. gbvrl181.seq - Viral sequence entries, part 181. 6833. gbvrl182.seq - Viral sequence entries, part 182. 6834. gbvrl183.seq - Viral sequence entries, part 183. 6835. gbvrl184.seq - Viral sequence entries, part 184. 6836. gbvrl185.seq - Viral sequence entries, part 185. 6837. gbvrl186.seq - Viral sequence entries, part 186. 6838. gbvrl187.seq - Viral sequence entries, part 187. 6839. gbvrl188.seq - Viral sequence entries, part 188. 6840. gbvrl189.seq - Viral sequence entries, part 189. 6841. gbvrl19.seq - Viral sequence entries, part 19. 6842. gbvrl190.seq - Viral sequence entries, part 190. 6843. gbvrl191.seq - Viral sequence entries, part 191. 6844. gbvrl192.seq - Viral sequence entries, part 192. 6845. gbvrl193.seq - Viral sequence entries, part 193. 6846. gbvrl194.seq - Viral sequence entries, part 194. 6847. gbvrl195.seq - Viral sequence entries, part 195. 6848. gbvrl196.seq - Viral sequence entries, part 196. 6849. gbvrl197.seq - Viral sequence entries, part 197. 6850. gbvrl198.seq - Viral sequence entries, part 198. 6851. gbvrl199.seq - Viral sequence entries, part 199. 6852. gbvrl2.seq - Viral sequence entries, part 2. 6853. gbvrl20.seq - Viral sequence entries, part 20. 6854. gbvrl200.seq - Viral sequence entries, part 200. 6855. gbvrl201.seq - Viral sequence entries, part 201. 6856. gbvrl202.seq - Viral sequence entries, part 202. 6857. gbvrl203.seq - Viral sequence entries, part 203. 6858. gbvrl204.seq - Viral sequence entries, part 204. 6859. gbvrl205.seq - Viral sequence entries, part 205. 6860. gbvrl206.seq - Viral sequence entries, part 206. 6861. gbvrl207.seq - Viral sequence entries, part 207. 6862. gbvrl208.seq - Viral sequence entries, part 208. 6863. gbvrl209.seq - Viral sequence entries, part 209. 6864. gbvrl21.seq - Viral sequence entries, part 21. 6865. gbvrl210.seq - Viral sequence entries, part 210. 6866. gbvrl211.seq - Viral sequence entries, part 211. 6867. gbvrl212.seq - Viral sequence entries, part 212. 6868. gbvrl213.seq - Viral sequence entries, part 213. 6869. gbvrl214.seq - Viral sequence entries, part 214. 6870. gbvrl215.seq - Viral sequence entries, part 215. 6871. gbvrl216.seq - Viral sequence entries, part 216. 6872. gbvrl217.seq - Viral sequence entries, part 217. 6873. gbvrl218.seq - Viral sequence entries, part 218. 6874. gbvrl219.seq - Viral sequence entries, part 219. 6875. gbvrl22.seq - Viral sequence entries, part 22. 6876. gbvrl220.seq - Viral sequence entries, part 220. 6877. gbvrl221.seq - Viral sequence entries, part 221. 6878. gbvrl222.seq - Viral sequence entries, part 222. 6879. gbvrl223.seq - Viral sequence entries, part 223. 6880. gbvrl224.seq - Viral sequence entries, part 224. 6881. gbvrl225.seq - Viral sequence entries, part 225. 6882. gbvrl226.seq - Viral sequence entries, part 226. 6883. gbvrl227.seq - Viral sequence entries, part 227. 6884. gbvrl228.seq - Viral sequence entries, part 228. 6885. gbvrl229.seq - Viral sequence entries, part 229. 6886. gbvrl23.seq - Viral sequence entries, part 23. 6887. gbvrl230.seq - Viral sequence entries, part 230. 6888. gbvrl231.seq - Viral sequence entries, part 231. 6889. gbvrl232.seq - Viral sequence entries, part 232. 6890. gbvrl233.seq - Viral sequence entries, part 233. 6891. gbvrl234.seq - Viral sequence entries, part 234. 6892. gbvrl235.seq - Viral sequence entries, part 235. 6893. gbvrl236.seq - Viral sequence entries, part 236. 6894. gbvrl237.seq - Viral sequence entries, part 237. 6895. gbvrl238.seq - Viral sequence entries, part 238. 6896. gbvrl239.seq - Viral sequence entries, part 239. 6897. gbvrl24.seq - Viral sequence entries, part 24. 6898. gbvrl240.seq - Viral sequence entries, part 240. 6899. gbvrl241.seq - Viral sequence entries, part 241. 6900. gbvrl242.seq - Viral sequence entries, part 242. 6901. gbvrl243.seq - Viral sequence entries, part 243. 6902. gbvrl244.seq - Viral sequence entries, part 244. 6903. gbvrl245.seq - Viral sequence entries, part 245. 6904. gbvrl246.seq - Viral sequence entries, part 246. 6905. gbvrl247.seq - Viral sequence entries, part 247. 6906. gbvrl248.seq - Viral sequence entries, part 248. 6907. gbvrl249.seq - Viral sequence entries, part 249. 6908. gbvrl25.seq - Viral sequence entries, part 25. 6909. gbvrl250.seq - Viral sequence entries, part 250. 6910. gbvrl251.seq - Viral sequence entries, part 251. 6911. gbvrl252.seq - Viral sequence entries, part 252. 6912. gbvrl253.seq - Viral sequence entries, part 253. 6913. gbvrl254.seq - Viral sequence entries, part 254. 6914. gbvrl255.seq - Viral sequence entries, part 255. 6915. gbvrl256.seq - Viral sequence entries, part 256. 6916. gbvrl257.seq - Viral sequence entries, part 257. 6917. gbvrl258.seq - Viral sequence entries, part 258. 6918. gbvrl259.seq - Viral sequence entries, part 259. 6919. gbvrl26.seq - Viral sequence entries, part 26. 6920. gbvrl260.seq - Viral sequence entries, part 260. 6921. gbvrl261.seq - Viral sequence entries, part 261. 6922. gbvrl262.seq - Viral sequence entries, part 262. 6923. gbvrl263.seq - Viral sequence entries, part 263. 6924. gbvrl264.seq - Viral sequence entries, part 264. 6925. gbvrl265.seq - Viral sequence entries, part 265. 6926. gbvrl266.seq - Viral sequence entries, part 266. 6927. gbvrl267.seq - Viral sequence entries, part 267. 6928. gbvrl268.seq - Viral sequence entries, part 268. 6929. gbvrl269.seq - Viral sequence entries, part 269. 6930. gbvrl27.seq - Viral sequence entries, part 27. 6931. gbvrl270.seq - Viral sequence entries, part 270. 6932. gbvrl271.seq - Viral sequence entries, part 271. 6933. gbvrl272.seq - Viral sequence entries, part 272. 6934. gbvrl273.seq - Viral sequence entries, part 273. 6935. gbvrl274.seq - Viral sequence entries, part 274. 6936. gbvrl275.seq - Viral sequence entries, part 275. 6937. gbvrl276.seq - Viral sequence entries, part 276. 6938. gbvrl277.seq - Viral sequence entries, part 277. 6939. gbvrl278.seq - Viral sequence entries, part 278. 6940. gbvrl279.seq - Viral sequence entries, part 279. 6941. gbvrl28.seq - Viral sequence entries, part 28. 6942. gbvrl280.seq - Viral sequence entries, part 280. 6943. gbvrl281.seq - Viral sequence entries, part 281. 6944. gbvrl282.seq - Viral sequence entries, part 282. 6945. gbvrl283.seq - Viral sequence entries, part 283. 6946. gbvrl284.seq - Viral sequence entries, part 284. 6947. gbvrl285.seq - Viral sequence entries, part 285. 6948. gbvrl286.seq - Viral sequence entries, part 286. 6949. gbvrl287.seq - Viral sequence entries, part 287. 6950. gbvrl288.seq - Viral sequence entries, part 288. 6951. gbvrl289.seq - Viral sequence entries, part 289. 6952. gbvrl29.seq - Viral sequence entries, part 29. 6953. gbvrl290.seq - Viral sequence entries, part 290. 6954. gbvrl291.seq - Viral sequence entries, part 291. 6955. gbvrl292.seq - Viral sequence entries, part 292. 6956. gbvrl293.seq - Viral sequence entries, part 293. 6957. gbvrl294.seq - Viral sequence entries, part 294. 6958. gbvrl295.seq - Viral sequence entries, part 295. 6959. gbvrl296.seq - Viral sequence entries, part 296. 6960. gbvrl297.seq - Viral sequence entries, part 297. 6961. gbvrl298.seq - Viral sequence entries, part 298. 6962. gbvrl299.seq - Viral sequence entries, part 299. 6963. gbvrl3.seq - Viral sequence entries, part 3. 6964. gbvrl30.seq - Viral sequence entries, part 30. 6965. gbvrl300.seq - Viral sequence entries, part 300. 6966. gbvrl301.seq - Viral sequence entries, part 301. 6967. gbvrl302.seq - Viral sequence entries, part 302. 6968. gbvrl303.seq - Viral sequence entries, part 303. 6969. gbvrl304.seq - Viral sequence entries, part 304. 6970. gbvrl305.seq - Viral sequence entries, part 305. 6971. gbvrl306.seq - Viral sequence entries, part 306. 6972. gbvrl307.seq - Viral sequence entries, part 307. 6973. gbvrl308.seq - Viral sequence entries, part 308. 6974. gbvrl309.seq - Viral sequence entries, part 309. 6975. gbvrl31.seq - Viral sequence entries, part 31. 6976. gbvrl310.seq - Viral sequence entries, part 310. 6977. gbvrl311.seq - Viral sequence entries, part 311. 6978. gbvrl312.seq - Viral sequence entries, part 312. 6979. gbvrl313.seq - Viral sequence entries, part 313. 6980. gbvrl314.seq - Viral sequence entries, part 314. 6981. gbvrl315.seq - Viral sequence entries, part 315. 6982. gbvrl316.seq - Viral sequence entries, part 316. 6983. gbvrl317.seq - Viral sequence entries, part 317. 6984. gbvrl318.seq - Viral sequence entries, part 318. 6985. gbvrl319.seq - Viral sequence entries, part 319. 6986. gbvrl32.seq - Viral sequence entries, part 32. 6987. gbvrl320.seq - Viral sequence entries, part 320. 6988. gbvrl321.seq - Viral sequence entries, part 321. 6989. gbvrl322.seq - Viral sequence entries, part 322. 6990. gbvrl323.seq - Viral sequence entries, part 323. 6991. gbvrl324.seq - Viral sequence entries, part 324. 6992. gbvrl325.seq - Viral sequence entries, part 325. 6993. gbvrl326.seq - Viral sequence entries, part 326. 6994. gbvrl327.seq - Viral sequence entries, part 327. 6995. gbvrl328.seq - Viral sequence entries, part 328. 6996. gbvrl329.seq - Viral sequence entries, part 329. 6997. gbvrl33.seq - Viral sequence entries, part 33. 6998. gbvrl330.seq - Viral sequence entries, part 330. 6999. gbvrl331.seq - Viral sequence entries, part 331. 7000. gbvrl332.seq - Viral sequence entries, part 332. 7001. gbvrl333.seq - Viral sequence entries, part 333. 7002. gbvrl334.seq - Viral sequence entries, part 334. 7003. gbvrl335.seq - Viral sequence entries, part 335. 7004. gbvrl336.seq - Viral sequence entries, part 336. 7005. gbvrl337.seq - Viral sequence entries, part 337. 7006. gbvrl338.seq - Viral sequence entries, part 338. 7007. gbvrl339.seq - Viral sequence entries, part 339. 7008. gbvrl34.seq - Viral sequence entries, part 34. 7009. gbvrl340.seq - Viral sequence entries, part 340. 7010. gbvrl341.seq - Viral sequence entries, part 341. 7011. gbvrl342.seq - Viral sequence entries, part 342. 7012. gbvrl343.seq - Viral sequence entries, part 343. 7013. gbvrl344.seq - Viral sequence entries, part 344. 7014. gbvrl345.seq - Viral sequence entries, part 345. 7015. gbvrl35.seq - Viral sequence entries, part 35. 7016. gbvrl36.seq - Viral sequence entries, part 36. 7017. gbvrl37.seq - Viral sequence entries, part 37. 7018. gbvrl38.seq - Viral sequence entries, part 38. 7019. gbvrl39.seq - Viral sequence entries, part 39. 7020. gbvrl4.seq - Viral sequence entries, part 4. 7021. gbvrl40.seq - Viral sequence entries, part 40. 7022. gbvrl41.seq - Viral sequence entries, part 41. 7023. gbvrl42.seq - Viral sequence entries, part 42. 7024. gbvrl43.seq - Viral sequence entries, part 43. 7025. gbvrl44.seq - Viral sequence entries, part 44. 7026. gbvrl45.seq - Viral sequence entries, part 45. 7027. gbvrl46.seq - Viral sequence entries, part 46. 7028. gbvrl47.seq - Viral sequence entries, part 47. 7029. gbvrl48.seq - Viral sequence entries, part 48. 7030. gbvrl49.seq - Viral sequence entries, part 49. 7031. gbvrl5.seq - Viral sequence entries, part 5. 7032. gbvrl50.seq - Viral sequence entries, part 50. 7033. gbvrl51.seq - Viral sequence entries, part 51. 7034. gbvrl52.seq - Viral sequence entries, part 52. 7035. gbvrl53.seq - Viral sequence entries, part 53. 7036. gbvrl54.seq - Viral sequence entries, part 54. 7037. gbvrl55.seq - Viral sequence entries, part 55. 7038. gbvrl56.seq - Viral sequence entries, part 56. 7039. gbvrl57.seq - Viral sequence entries, part 57. 7040. gbvrl58.seq - Viral sequence entries, part 58. 7041. gbvrl59.seq - Viral sequence entries, part 59. 7042. gbvrl6.seq - Viral sequence entries, part 6. 7043. gbvrl60.seq - Viral sequence entries, part 60. 7044. gbvrl61.seq - Viral sequence entries, part 61. 7045. gbvrl62.seq - Viral sequence entries, part 62. 7046. gbvrl63.seq - Viral sequence entries, part 63. 7047. gbvrl64.seq - Viral sequence entries, part 64. 7048. gbvrl65.seq - Viral sequence entries, part 65. 7049. gbvrl66.seq - Viral sequence entries, part 66. 7050. gbvrl67.seq - Viral sequence entries, part 67. 7051. gbvrl68.seq - Viral sequence entries, part 68. 7052. gbvrl69.seq - Viral sequence entries, part 69. 7053. gbvrl7.seq - Viral sequence entries, part 7. 7054. gbvrl70.seq - Viral sequence entries, part 70. 7055. gbvrl71.seq - Viral sequence entries, part 71. 7056. gbvrl72.seq - Viral sequence entries, part 72. 7057. gbvrl73.seq - Viral sequence entries, part 73. 7058. gbvrl74.seq - Viral sequence entries, part 74. 7059. gbvrl75.seq - Viral sequence entries, part 75. 7060. gbvrl76.seq - Viral sequence entries, part 76. 7061. gbvrl77.seq - Viral sequence entries, part 77. 7062. gbvrl78.seq - Viral sequence entries, part 78. 7063. gbvrl79.seq - Viral sequence entries, part 79. 7064. gbvrl8.seq - Viral sequence entries, part 8. 7065. gbvrl80.seq - Viral sequence entries, part 80. 7066. gbvrl81.seq - Viral sequence entries, part 81. 7067. gbvrl82.seq - Viral sequence entries, part 82. 7068. gbvrl83.seq - Viral sequence entries, part 83. 7069. gbvrl84.seq - Viral sequence entries, part 84. 7070. gbvrl85.seq - Viral sequence entries, part 85. 7071. gbvrl86.seq - Viral sequence entries, part 86. 7072. gbvrl87.seq - Viral sequence entries, part 87. 7073. gbvrl88.seq - Viral sequence entries, part 88. 7074. gbvrl89.seq - Viral sequence entries, part 89. 7075. gbvrl9.seq - Viral sequence entries, part 9. 7076. gbvrl90.seq - Viral sequence entries, part 90. 7077. gbvrl91.seq - Viral sequence entries, part 91. 7078. gbvrl92.seq - Viral sequence entries, part 92. 7079. gbvrl93.seq - Viral sequence entries, part 93. 7080. gbvrl94.seq - Viral sequence entries, part 94. 7081. gbvrl95.seq - Viral sequence entries, part 95. 7082. gbvrl96.seq - Viral sequence entries, part 96. 7083. gbvrl97.seq - Viral sequence entries, part 97. 7084. gbvrl98.seq - Viral sequence entries, part 98. 7085. gbvrl99.seq - Viral sequence entries, part 99. 7086. gbvrt1.seq - Other vertebrate sequence entries, part 1. 7087. gbvrt10.seq - Other vertebrate sequence entries, part 10. 7088. gbvrt100.seq - Other vertebrate sequence entries, part 100. 7089. gbvrt101.seq - Other vertebrate sequence entries, part 101. 7090. gbvrt102.seq - Other vertebrate sequence entries, part 102. 7091. gbvrt103.seq - Other vertebrate sequence entries, part 103. 7092. gbvrt104.seq - Other vertebrate sequence entries, part 104. 7093. gbvrt105.seq - Other vertebrate sequence entries, part 105. 7094. gbvrt106.seq - Other vertebrate sequence entries, part 106. 7095. gbvrt107.seq - Other vertebrate sequence entries, part 107. 7096. gbvrt108.seq - Other vertebrate sequence entries, part 108. 7097. gbvrt109.seq - Other vertebrate sequence entries, part 109. 7098. gbvrt11.seq - Other vertebrate sequence entries, part 11. 7099. gbvrt110.seq - Other vertebrate sequence entries, part 110. 7100. gbvrt111.seq - Other vertebrate sequence entries, part 111. 7101. gbvrt112.seq - Other vertebrate sequence entries, part 112. 7102. gbvrt113.seq - Other vertebrate sequence entries, part 113. 7103. gbvrt114.seq - Other vertebrate sequence entries, part 114. 7104. gbvrt115.seq - Other vertebrate sequence entries, part 115. 7105. gbvrt116.seq - Other vertebrate sequence entries, part 116. 7106. gbvrt117.seq - Other vertebrate sequence entries, part 117. 7107. gbvrt118.seq - Other vertebrate sequence entries, part 118. 7108. gbvrt119.seq - Other vertebrate sequence entries, part 119. 7109. gbvrt12.seq - Other vertebrate sequence entries, part 12. 7110. gbvrt120.seq - Other vertebrate sequence entries, part 120. 7111. gbvrt121.seq - Other vertebrate sequence entries, part 121. 7112. gbvrt122.seq - Other vertebrate sequence entries, part 122. 7113. gbvrt123.seq - Other vertebrate sequence entries, part 123. 7114. gbvrt124.seq - Other vertebrate sequence entries, part 124. 7115. gbvrt125.seq - Other vertebrate sequence entries, part 125. 7116. gbvrt126.seq - Other vertebrate sequence entries, part 126. 7117. gbvrt127.seq - Other vertebrate sequence entries, part 127. 7118. gbvrt128.seq - Other vertebrate sequence entries, part 128. 7119. gbvrt129.seq - Other vertebrate sequence entries, part 129. 7120. gbvrt13.seq - Other vertebrate sequence entries, part 13. 7121. gbvrt130.seq - Other vertebrate sequence entries, part 130. 7122. gbvrt131.seq - Other vertebrate sequence entries, part 131. 7123. gbvrt132.seq - Other vertebrate sequence entries, part 132. 7124. gbvrt133.seq - Other vertebrate sequence entries, part 133. 7125. gbvrt134.seq - Other vertebrate sequence entries, part 134. 7126. gbvrt135.seq - Other vertebrate sequence entries, part 135. 7127. gbvrt136.seq - Other vertebrate sequence entries, part 136. 7128. gbvrt137.seq - Other vertebrate sequence entries, part 137. 7129. gbvrt138.seq - Other vertebrate sequence entries, part 138. 7130. gbvrt139.seq - Other vertebrate sequence entries, part 139. 7131. gbvrt14.seq - Other vertebrate sequence entries, part 14. 7132. gbvrt140.seq - Other vertebrate sequence entries, part 140. 7133. gbvrt141.seq - Other vertebrate sequence entries, part 141. 7134. gbvrt142.seq - Other vertebrate sequence entries, part 142. 7135. gbvrt143.seq - Other vertebrate sequence entries, part 143. 7136. gbvrt144.seq - Other vertebrate sequence entries, part 144. 7137. gbvrt145.seq - Other vertebrate sequence entries, part 145. 7138. gbvrt146.seq - Other vertebrate sequence entries, part 146. 7139. gbvrt147.seq - Other vertebrate sequence entries, part 147. 7140. gbvrt148.seq - Other vertebrate sequence entries, part 148. 7141. gbvrt149.seq - Other vertebrate sequence entries, part 149. 7142. gbvrt15.seq - Other vertebrate sequence entries, part 15. 7143. gbvrt150.seq - Other vertebrate sequence entries, part 150. 7144. gbvrt151.seq - Other vertebrate sequence entries, part 151. 7145. gbvrt152.seq - Other vertebrate sequence entries, part 152. 7146. gbvrt153.seq - Other vertebrate sequence entries, part 153. 7147. gbvrt154.seq - Other vertebrate sequence entries, part 154. 7148. gbvrt155.seq - Other vertebrate sequence entries, part 155. 7149. gbvrt156.seq - Other vertebrate sequence entries, part 156. 7150. gbvrt157.seq - Other vertebrate sequence entries, part 157. 7151. gbvrt158.seq - Other vertebrate sequence entries, part 158. 7152. gbvrt159.seq - Other vertebrate sequence entries, part 159. 7153. gbvrt16.seq - Other vertebrate sequence entries, part 16. 7154. gbvrt160.seq - Other vertebrate sequence entries, part 160. 7155. gbvrt161.seq - Other vertebrate sequence entries, part 161. 7156. gbvrt162.seq - Other vertebrate sequence entries, part 162. 7157. gbvrt163.seq - Other vertebrate sequence entries, part 163. 7158. gbvrt164.seq - Other vertebrate sequence entries, part 164. 7159. gbvrt165.seq - Other vertebrate sequence entries, part 165. 7160. gbvrt166.seq - Other vertebrate sequence entries, part 166. 7161. gbvrt167.seq - Other vertebrate sequence entries, part 167. 7162. gbvrt168.seq - Other vertebrate sequence entries, part 168. 7163. gbvrt169.seq - Other vertebrate sequence entries, part 169. 7164. gbvrt17.seq - Other vertebrate sequence entries, part 17. 7165. gbvrt170.seq - Other vertebrate sequence entries, part 170. 7166. gbvrt171.seq - Other vertebrate sequence entries, part 171. 7167. gbvrt172.seq - Other vertebrate sequence entries, part 172. 7168. gbvrt173.seq - Other vertebrate sequence entries, part 173. 7169. gbvrt174.seq - Other vertebrate sequence entries, part 174. 7170. gbvrt175.seq - Other vertebrate sequence entries, part 175. 7171. gbvrt176.seq - Other vertebrate sequence entries, part 176. 7172. gbvrt177.seq - Other vertebrate sequence entries, part 177. 7173. gbvrt178.seq - Other vertebrate sequence entries, part 178. 7174. gbvrt179.seq - Other vertebrate sequence entries, part 179. 7175. gbvrt18.seq - Other vertebrate sequence entries, part 18. 7176. gbvrt180.seq - Other vertebrate sequence entries, part 180. 7177. gbvrt181.seq - Other vertebrate sequence entries, part 181. 7178. gbvrt182.seq - Other vertebrate sequence entries, part 182. 7179. gbvrt183.seq - Other vertebrate sequence entries, part 183. 7180. gbvrt184.seq - Other vertebrate sequence entries, part 184. 7181. gbvrt185.seq - Other vertebrate sequence entries, part 185. 7182. gbvrt186.seq - Other vertebrate sequence entries, part 186. 7183. gbvrt187.seq - Other vertebrate sequence entries, part 187. 7184. gbvrt188.seq - Other vertebrate sequence entries, part 188. 7185. gbvrt189.seq - Other vertebrate sequence entries, part 189. 7186. gbvrt19.seq - Other vertebrate sequence entries, part 19. 7187. gbvrt190.seq - Other vertebrate sequence entries, part 190. 7188. gbvrt191.seq - Other vertebrate sequence entries, part 191. 7189. gbvrt192.seq - Other vertebrate sequence entries, part 192. 7190. gbvrt193.seq - Other vertebrate sequence entries, part 193. 7191. gbvrt194.seq - Other vertebrate sequence entries, part 194. 7192. gbvrt195.seq - Other vertebrate sequence entries, part 195. 7193. gbvrt196.seq - Other vertebrate sequence entries, part 196. 7194. gbvrt197.seq - Other vertebrate sequence entries, part 197. 7195. gbvrt198.seq - Other vertebrate sequence entries, part 198. 7196. gbvrt199.seq - Other vertebrate sequence entries, part 199. 7197. gbvrt2.seq - Other vertebrate sequence entries, part 2. 7198. gbvrt20.seq - Other vertebrate sequence entries, part 20. 7199. gbvrt200.seq - Other vertebrate sequence entries, part 200. 7200. gbvrt201.seq - Other vertebrate sequence entries, part 201. 7201. gbvrt202.seq - Other vertebrate sequence entries, part 202. 7202. gbvrt203.seq - Other vertebrate sequence entries, part 203. 7203. gbvrt204.seq - Other vertebrate sequence entries, part 204. 7204. gbvrt205.seq - Other vertebrate sequence entries, part 205. 7205. gbvrt206.seq - Other vertebrate sequence entries, part 206. 7206. gbvrt207.seq - Other vertebrate sequence entries, part 207. 7207. gbvrt208.seq - Other vertebrate sequence entries, part 208. 7208. gbvrt209.seq - Other vertebrate sequence entries, part 209. 7209. gbvrt21.seq - Other vertebrate sequence entries, part 21. 7210. gbvrt210.seq - Other vertebrate sequence entries, part 210. 7211. gbvrt211.seq - Other vertebrate sequence entries, part 211. 7212. gbvrt212.seq - Other vertebrate sequence entries, part 212. 7213. gbvrt213.seq - Other vertebrate sequence entries, part 213. 7214. gbvrt214.seq - Other vertebrate sequence entries, part 214. 7215. gbvrt215.seq - Other vertebrate sequence entries, part 215. 7216. gbvrt216.seq - Other vertebrate sequence entries, part 216. 7217. gbvrt217.seq - Other vertebrate sequence entries, part 217. 7218. gbvrt218.seq - Other vertebrate sequence entries, part 218. 7219. gbvrt219.seq - Other vertebrate sequence entries, part 219. 7220. gbvrt22.seq - Other vertebrate sequence entries, part 22. 7221. gbvrt220.seq - Other vertebrate sequence entries, part 220. 7222. gbvrt221.seq - Other vertebrate sequence entries, part 221. 7223. gbvrt222.seq - Other vertebrate sequence entries, part 222. 7224. gbvrt223.seq - Other vertebrate sequence entries, part 223. 7225. gbvrt224.seq - Other vertebrate sequence entries, part 224. 7226. gbvrt225.seq - Other vertebrate sequence entries, part 225. 7227. gbvrt226.seq - Other vertebrate sequence entries, part 226. 7228. gbvrt227.seq - Other vertebrate sequence entries, part 227. 7229. gbvrt228.seq - Other vertebrate sequence entries, part 228. 7230. gbvrt229.seq - Other vertebrate sequence entries, part 229. 7231. gbvrt23.seq - Other vertebrate sequence entries, part 23. 7232. gbvrt230.seq - Other vertebrate sequence entries, part 230. 7233. gbvrt231.seq - Other vertebrate sequence entries, part 231. 7234. gbvrt232.seq - Other vertebrate sequence entries, part 232. 7235. gbvrt233.seq - Other vertebrate sequence entries, part 233. 7236. gbvrt234.seq - Other vertebrate sequence entries, part 234. 7237. gbvrt235.seq - Other vertebrate sequence entries, part 235. 7238. gbvrt236.seq - Other vertebrate sequence entries, part 236. 7239. gbvrt237.seq - Other vertebrate sequence entries, part 237. 7240. gbvrt238.seq - Other vertebrate sequence entries, part 238. 7241. gbvrt239.seq - Other vertebrate sequence entries, part 239. 7242. gbvrt24.seq - Other vertebrate sequence entries, part 24. 7243. gbvrt240.seq - Other vertebrate sequence entries, part 240. 7244. gbvrt241.seq - Other vertebrate sequence entries, part 241. 7245. gbvrt242.seq - Other vertebrate sequence entries, part 242. 7246. gbvrt243.seq - Other vertebrate sequence entries, part 243. 7247. gbvrt244.seq - Other vertebrate sequence entries, part 244. 7248. gbvrt245.seq - Other vertebrate sequence entries, part 245. 7249. gbvrt246.seq - Other vertebrate sequence entries, part 246. 7250. gbvrt247.seq - Other vertebrate sequence entries, part 247. 7251. gbvrt248.seq - Other vertebrate sequence entries, part 248. 7252. gbvrt249.seq - Other vertebrate sequence entries, part 249. 7253. gbvrt25.seq - Other vertebrate sequence entries, part 25. 7254. gbvrt250.seq - Other vertebrate sequence entries, part 250. 7255. gbvrt251.seq - Other vertebrate sequence entries, part 251. 7256. gbvrt252.seq - Other vertebrate sequence entries, part 252. 7257. gbvrt253.seq - Other vertebrate sequence entries, part 253. 7258. gbvrt254.seq - Other vertebrate sequence entries, part 254. 7259. gbvrt255.seq - Other vertebrate sequence entries, part 255. 7260. gbvrt256.seq - Other vertebrate sequence entries, part 256. 7261. gbvrt257.seq - Other vertebrate sequence entries, part 257. 7262. gbvrt258.seq - Other vertebrate sequence entries, part 258. 7263. gbvrt259.seq - Other vertebrate sequence entries, part 259. 7264. gbvrt26.seq - Other vertebrate sequence entries, part 26. 7265. gbvrt260.seq - Other vertebrate sequence entries, part 260. 7266. gbvrt261.seq - Other vertebrate sequence entries, part 261. 7267. gbvrt262.seq - Other vertebrate sequence entries, part 262. 7268. gbvrt263.seq - Other vertebrate sequence entries, part 263. 7269. gbvrt264.seq - Other vertebrate sequence entries, part 264. 7270. gbvrt265.seq - Other vertebrate sequence entries, part 265. 7271. gbvrt266.seq - Other vertebrate sequence entries, part 266. 7272. gbvrt267.seq - Other vertebrate sequence entries, part 267. 7273. gbvrt268.seq - Other vertebrate sequence entries, part 268. 7274. gbvrt269.seq - Other vertebrate sequence entries, part 269. 7275. gbvrt27.seq - Other vertebrate sequence entries, part 27. 7276. gbvrt270.seq - Other vertebrate sequence entries, part 270. 7277. gbvrt271.seq - Other vertebrate sequence entries, part 271. 7278. gbvrt272.seq - Other vertebrate sequence entries, part 272. 7279. gbvrt273.seq - Other vertebrate sequence entries, part 273. 7280. gbvrt274.seq - Other vertebrate sequence entries, part 274. 7281. gbvrt275.seq - Other vertebrate sequence entries, part 275. 7282. gbvrt276.seq - Other vertebrate sequence entries, part 276. 7283. gbvrt277.seq - Other vertebrate sequence entries, part 277. 7284. gbvrt278.seq - Other vertebrate sequence entries, part 278. 7285. gbvrt279.seq - Other vertebrate sequence entries, part 279. 7286. gbvrt28.seq - Other vertebrate sequence entries, part 28. 7287. gbvrt280.seq - Other vertebrate sequence entries, part 280. 7288. gbvrt281.seq - Other vertebrate sequence entries, part 281. 7289. gbvrt282.seq - Other vertebrate sequence entries, part 282. 7290. gbvrt283.seq - Other vertebrate sequence entries, part 283. 7291. gbvrt284.seq - Other vertebrate sequence entries, part 284. 7292. gbvrt285.seq - Other vertebrate sequence entries, part 285. 7293. gbvrt286.seq - Other vertebrate sequence entries, part 286. 7294. gbvrt287.seq - Other vertebrate sequence entries, part 287. 7295. gbvrt288.seq - Other vertebrate sequence entries, part 288. 7296. gbvrt289.seq - Other vertebrate sequence entries, part 289. 7297. gbvrt29.seq - Other vertebrate sequence entries, part 29. 7298. gbvrt290.seq - Other vertebrate sequence entries, part 290. 7299. gbvrt291.seq - Other vertebrate sequence entries, part 291. 7300. gbvrt292.seq - Other vertebrate sequence entries, part 292. 7301. gbvrt293.seq - Other vertebrate sequence entries, part 293. 7302. gbvrt294.seq - Other vertebrate sequence entries, part 294. 7303. gbvrt295.seq - Other vertebrate sequence entries, part 295. 7304. gbvrt296.seq - Other vertebrate sequence entries, part 296. 7305. gbvrt297.seq - Other vertebrate sequence entries, part 297. 7306. gbvrt298.seq - Other vertebrate sequence entries, part 298. 7307. gbvrt299.seq - Other vertebrate sequence entries, part 299. 7308. gbvrt3.seq - Other vertebrate sequence entries, part 3. 7309. gbvrt30.seq - Other vertebrate sequence entries, part 30. 7310. gbvrt300.seq - Other vertebrate sequence entries, part 300. 7311. gbvrt301.seq - Other vertebrate sequence entries, part 301. 7312. gbvrt302.seq - Other vertebrate sequence entries, part 302. 7313. gbvrt303.seq - Other vertebrate sequence entries, part 303. 7314. gbvrt304.seq - Other vertebrate sequence entries, part 304. 7315. gbvrt305.seq - Other vertebrate sequence entries, part 305. 7316. gbvrt306.seq - Other vertebrate sequence entries, part 306. 7317. gbvrt307.seq - Other vertebrate sequence entries, part 307. 7318. gbvrt308.seq - Other vertebrate sequence entries, part 308. 7319. gbvrt309.seq - Other vertebrate sequence entries, part 309. 7320. gbvrt31.seq - Other vertebrate sequence entries, part 31. 7321. gbvrt310.seq - Other vertebrate sequence entries, part 310. 7322. gbvrt311.seq - Other vertebrate sequence entries, part 311. 7323. gbvrt312.seq - Other vertebrate sequence entries, part 312. 7324. gbvrt313.seq - Other vertebrate sequence entries, part 313. 7325. gbvrt314.seq - Other vertebrate sequence entries, part 314. 7326. gbvrt315.seq - Other vertebrate sequence entries, part 315. 7327. gbvrt316.seq - Other vertebrate sequence entries, part 316. 7328. gbvrt317.seq - Other vertebrate sequence entries, part 317. 7329. gbvrt318.seq - Other vertebrate sequence entries, part 318. 7330. gbvrt319.seq - Other vertebrate sequence entries, part 319. 7331. gbvrt32.seq - Other vertebrate sequence entries, part 32. 7332. gbvrt320.seq - Other vertebrate sequence entries, part 320. 7333. gbvrt321.seq - Other vertebrate sequence entries, part 321. 7334. gbvrt322.seq - Other vertebrate sequence entries, part 322. 7335. gbvrt323.seq - Other vertebrate sequence entries, part 323. 7336. gbvrt324.seq - Other vertebrate sequence entries, part 324. 7337. gbvrt325.seq - Other vertebrate sequence entries, part 325. 7338. gbvrt326.seq - Other vertebrate sequence entries, part 326. 7339. gbvrt327.seq - Other vertebrate sequence entries, part 327. 7340. gbvrt328.seq - Other vertebrate sequence entries, part 328. 7341. gbvrt329.seq - Other vertebrate sequence entries, part 329. 7342. gbvrt33.seq - Other vertebrate sequence entries, part 33. 7343. gbvrt330.seq - Other vertebrate sequence entries, part 330. 7344. gbvrt331.seq - Other vertebrate sequence entries, part 331. 7345. gbvrt332.seq - Other vertebrate sequence entries, part 332. 7346. gbvrt333.seq - Other vertebrate sequence entries, part 333. 7347. gbvrt334.seq - Other vertebrate sequence entries, part 334. 7348. gbvrt335.seq - Other vertebrate sequence entries, part 335. 7349. gbvrt336.seq - Other vertebrate sequence entries, part 336. 7350. gbvrt337.seq - Other vertebrate sequence entries, part 337. 7351. gbvrt338.seq - Other vertebrate sequence entries, part 338. 7352. gbvrt339.seq - Other vertebrate sequence entries, part 339. 7353. gbvrt34.seq - Other vertebrate sequence entries, part 34. 7354. gbvrt340.seq - Other vertebrate sequence entries, part 340. 7355. gbvrt341.seq - Other vertebrate sequence entries, part 341. 7356. gbvrt342.seq - Other vertebrate sequence entries, part 342. 7357. gbvrt343.seq - Other vertebrate sequence entries, part 343. 7358. gbvrt344.seq - Other vertebrate sequence entries, part 344. 7359. gbvrt345.seq - Other vertebrate sequence entries, part 345. 7360. gbvrt346.seq - Other vertebrate sequence entries, part 346. 7361. gbvrt347.seq - Other vertebrate sequence entries, part 347. 7362. gbvrt348.seq - Other vertebrate sequence entries, part 348. 7363. gbvrt349.seq - Other vertebrate sequence entries, part 349. 7364. gbvrt35.seq - Other vertebrate sequence entries, part 35. 7365. gbvrt350.seq - Other vertebrate sequence entries, part 350. 7366. gbvrt351.seq - Other vertebrate sequence entries, part 351. 7367. gbvrt352.seq - Other vertebrate sequence entries, part 352. 7368. gbvrt353.seq - Other vertebrate sequence entries, part 353. 7369. gbvrt354.seq - Other vertebrate sequence entries, part 354. 7370. gbvrt355.seq - Other vertebrate sequence entries, part 355. 7371. gbvrt356.seq - Other vertebrate sequence entries, part 356. 7372. gbvrt357.seq - Other vertebrate sequence entries, part 357. 7373. gbvrt358.seq - Other vertebrate sequence entries, part 358. 7374. gbvrt359.seq - Other vertebrate sequence entries, part 359. 7375. gbvrt36.seq - Other vertebrate sequence entries, part 36. 7376. gbvrt360.seq - Other vertebrate sequence entries, part 360. 7377. gbvrt361.seq - Other vertebrate sequence entries, part 361. 7378. gbvrt362.seq - Other vertebrate sequence entries, part 362. 7379. gbvrt363.seq - Other vertebrate sequence entries, part 363. 7380. gbvrt364.seq - Other vertebrate sequence entries, part 364. 7381. gbvrt365.seq - Other vertebrate sequence entries, part 365. 7382. gbvrt366.seq - Other vertebrate sequence entries, part 366. 7383. gbvrt367.seq - Other vertebrate sequence entries, part 367. 7384. gbvrt368.seq - Other vertebrate sequence entries, part 368. 7385. gbvrt369.seq - Other vertebrate sequence entries, part 369. 7386. gbvrt37.seq - Other vertebrate sequence entries, part 37. 7387. gbvrt370.seq - Other vertebrate sequence entries, part 370. 7388. gbvrt371.seq - Other vertebrate sequence entries, part 371. 7389. gbvrt372.seq - Other vertebrate sequence entries, part 372. 7390. gbvrt373.seq - Other vertebrate sequence entries, part 373. 7391. gbvrt374.seq - Other vertebrate sequence entries, part 374. 7392. gbvrt375.seq - Other vertebrate sequence entries, part 375. 7393. gbvrt376.seq - Other vertebrate sequence entries, part 376. 7394. gbvrt377.seq - Other vertebrate sequence entries, part 377. 7395. gbvrt378.seq - Other vertebrate sequence entries, part 378. 7396. gbvrt379.seq - Other vertebrate sequence entries, part 379. 7397. gbvrt38.seq - Other vertebrate sequence entries, part 38. 7398. gbvrt380.seq - Other vertebrate sequence entries, part 380. 7399. gbvrt381.seq - Other vertebrate sequence entries, part 381. 7400. gbvrt382.seq - Other vertebrate sequence entries, part 382. 7401. gbvrt383.seq - Other vertebrate sequence entries, part 383. 7402. gbvrt384.seq - Other vertebrate sequence entries, part 384. 7403. gbvrt385.seq - Other vertebrate sequence entries, part 385. 7404. gbvrt386.seq - Other vertebrate sequence entries, part 386. 7405. gbvrt387.seq - Other vertebrate sequence entries, part 387. 7406. gbvrt388.seq - Other vertebrate sequence entries, part 388. 7407. gbvrt389.seq - Other vertebrate sequence entries, part 389. 7408. gbvrt39.seq - Other vertebrate sequence entries, part 39. 7409. gbvrt390.seq - Other vertebrate sequence entries, part 390. 7410. gbvrt391.seq - Other vertebrate sequence entries, part 391. 7411. gbvrt392.seq - Other vertebrate sequence entries, part 392. 7412. gbvrt393.seq - Other vertebrate sequence entries, part 393. 7413. gbvrt394.seq - Other vertebrate sequence entries, part 394. 7414. gbvrt395.seq - Other vertebrate sequence entries, part 395. 7415. gbvrt396.seq - Other vertebrate sequence entries, part 396. 7416. gbvrt397.seq - Other vertebrate sequence entries, part 397. 7417. gbvrt398.seq - Other vertebrate sequence entries, part 398. 7418. gbvrt399.seq - Other vertebrate sequence entries, part 399. 7419. gbvrt4.seq - Other vertebrate sequence entries, part 4. 7420. gbvrt40.seq - Other vertebrate sequence entries, part 40. 7421. gbvrt400.seq - Other vertebrate sequence entries, part 400. 7422. gbvrt401.seq - Other vertebrate sequence entries, part 401. 7423. gbvrt402.seq - Other vertebrate sequence entries, part 402. 7424. gbvrt403.seq - Other vertebrate sequence entries, part 403. 7425. gbvrt404.seq - Other vertebrate sequence entries, part 404. 7426. gbvrt405.seq - Other vertebrate sequence entries, part 405. 7427. gbvrt406.seq - Other vertebrate sequence entries, part 406. 7428. gbvrt407.seq - Other vertebrate sequence entries, part 407. 7429. gbvrt408.seq - Other vertebrate sequence entries, part 408. 7430. gbvrt409.seq - Other vertebrate sequence entries, part 409. 7431. gbvrt41.seq - Other vertebrate sequence entries, part 41. 7432. gbvrt410.seq - Other vertebrate sequence entries, part 410. 7433. gbvrt411.seq - Other vertebrate sequence entries, part 411. 7434. gbvrt412.seq - Other vertebrate sequence entries, part 412. 7435. gbvrt413.seq - Other vertebrate sequence entries, part 413. 7436. gbvrt414.seq - Other vertebrate sequence entries, part 414. 7437. gbvrt415.seq - Other vertebrate sequence entries, part 415. 7438. gbvrt416.seq - Other vertebrate sequence entries, part 416. 7439. gbvrt417.seq - Other vertebrate sequence entries, part 417. 7440. gbvrt418.seq - Other vertebrate sequence entries, part 418. 7441. gbvrt419.seq - Other vertebrate sequence entries, part 419. 7442. gbvrt42.seq - Other vertebrate sequence entries, part 42. 7443. gbvrt420.seq - Other vertebrate sequence entries, part 420. 7444. gbvrt421.seq - Other vertebrate sequence entries, part 421. 7445. gbvrt422.seq - Other vertebrate sequence entries, part 422. 7446. gbvrt423.seq - Other vertebrate sequence entries, part 423. 7447. gbvrt424.seq - Other vertebrate sequence entries, part 424. 7448. gbvrt425.seq - Other vertebrate sequence entries, part 425. 7449. gbvrt426.seq - Other vertebrate sequence entries, part 426. 7450. gbvrt427.seq - Other vertebrate sequence entries, part 427. 7451. gbvrt428.seq - Other vertebrate sequence entries, part 428. 7452. gbvrt429.seq - Other vertebrate sequence entries, part 429. 7453. gbvrt43.seq - Other vertebrate sequence entries, part 43. 7454. gbvrt430.seq - Other vertebrate sequence entries, part 430. 7455. gbvrt431.seq - Other vertebrate sequence entries, part 431. 7456. gbvrt432.seq - Other vertebrate sequence entries, part 432. 7457. gbvrt433.seq - Other vertebrate sequence entries, part 433. 7458. gbvrt434.seq - Other vertebrate sequence entries, part 434. 7459. gbvrt435.seq - Other vertebrate sequence entries, part 435. 7460. gbvrt436.seq - Other vertebrate sequence entries, part 436. 7461. gbvrt437.seq - Other vertebrate sequence entries, part 437. 7462. gbvrt438.seq - Other vertebrate sequence entries, part 438. 7463. gbvrt439.seq - Other vertebrate sequence entries, part 439. 7464. gbvrt44.seq - Other vertebrate sequence entries, part 44. 7465. gbvrt440.seq - Other vertebrate sequence entries, part 440. 7466. gbvrt441.seq - Other vertebrate sequence entries, part 441. 7467. gbvrt442.seq - Other vertebrate sequence entries, part 442. 7468. gbvrt443.seq - Other vertebrate sequence entries, part 443. 7469. gbvrt444.seq - Other vertebrate sequence entries, part 444. 7470. gbvrt445.seq - Other vertebrate sequence entries, part 445. 7471. gbvrt446.seq - Other vertebrate sequence entries, part 446. 7472. gbvrt447.seq - Other vertebrate sequence entries, part 447. 7473. gbvrt448.seq - Other vertebrate sequence entries, part 448. 7474. gbvrt449.seq - Other vertebrate sequence entries, part 449. 7475. gbvrt45.seq - Other vertebrate sequence entries, part 45. 7476. gbvrt450.seq - Other vertebrate sequence entries, part 450. 7477. gbvrt451.seq - Other vertebrate sequence entries, part 451. 7478. gbvrt452.seq - Other vertebrate sequence entries, part 452. 7479. gbvrt453.seq - Other vertebrate sequence entries, part 453. 7480. gbvrt454.seq - Other vertebrate sequence entries, part 454. 7481. gbvrt455.seq - Other vertebrate sequence entries, part 455. 7482. gbvrt456.seq - Other vertebrate sequence entries, part 456. 7483. gbvrt457.seq - Other vertebrate sequence entries, part 457. 7484. gbvrt458.seq - Other vertebrate sequence entries, part 458. 7485. gbvrt459.seq - Other vertebrate sequence entries, part 459. 7486. gbvrt46.seq - Other vertebrate sequence entries, part 46. 7487. gbvrt460.seq - Other vertebrate sequence entries, part 460. 7488. gbvrt461.seq - Other vertebrate sequence entries, part 461. 7489. gbvrt462.seq - Other vertebrate sequence entries, part 462. 7490. gbvrt463.seq - Other vertebrate sequence entries, part 463. 7491. gbvrt464.seq - Other vertebrate sequence entries, part 464. 7492. gbvrt465.seq - Other vertebrate sequence entries, part 465. 7493. gbvrt466.seq - Other vertebrate sequence entries, part 466. 7494. gbvrt467.seq - Other vertebrate sequence entries, part 467. 7495. gbvrt468.seq - Other vertebrate sequence entries, part 468. 7496. gbvrt469.seq - Other vertebrate sequence entries, part 469. 7497. gbvrt47.seq - Other vertebrate sequence entries, part 47. 7498. gbvrt470.seq - Other vertebrate sequence entries, part 470. 7499. gbvrt471.seq - Other vertebrate sequence entries, part 471. 7500. gbvrt472.seq - Other vertebrate sequence entries, part 472. 7501. gbvrt473.seq - Other vertebrate sequence entries, part 473. 7502. gbvrt474.seq - Other vertebrate sequence entries, part 474. 7503. gbvrt475.seq - Other vertebrate sequence entries, part 475. 7504. gbvrt476.seq - Other vertebrate sequence entries, part 476. 7505. gbvrt477.seq - Other vertebrate sequence entries, part 477. 7506. gbvrt478.seq - Other vertebrate sequence entries, part 478. 7507. gbvrt479.seq - Other vertebrate sequence entries, part 479. 7508. gbvrt48.seq - Other vertebrate sequence entries, part 48. 7509. gbvrt480.seq - Other vertebrate sequence entries, part 480. 7510. gbvrt481.seq - Other vertebrate sequence entries, part 481. 7511. gbvrt482.seq - Other vertebrate sequence entries, part 482. 7512. gbvrt483.seq - Other vertebrate sequence entries, part 483. 7513. gbvrt484.seq - Other vertebrate sequence entries, part 484. 7514. gbvrt485.seq - Other vertebrate sequence entries, part 485. 7515. gbvrt486.seq - Other vertebrate sequence entries, part 486. 7516. gbvrt487.seq - Other vertebrate sequence entries, part 487. 7517. gbvrt488.seq - Other vertebrate sequence entries, part 488. 7518. gbvrt489.seq - Other vertebrate sequence entries, part 489. 7519. gbvrt49.seq - Other vertebrate sequence entries, part 49. 7520. gbvrt490.seq - Other vertebrate sequence entries, part 490. 7521. gbvrt491.seq - Other vertebrate sequence entries, part 491. 7522. gbvrt492.seq - Other vertebrate sequence entries, part 492. 7523. gbvrt493.seq - Other vertebrate sequence entries, part 493. 7524. gbvrt494.seq - Other vertebrate sequence entries, part 494. 7525. gbvrt495.seq - Other vertebrate sequence entries, part 495. 7526. gbvrt496.seq - Other vertebrate sequence entries, part 496. 7527. gbvrt497.seq - Other vertebrate sequence entries, part 497. 7528. gbvrt498.seq - Other vertebrate sequence entries, part 498. 7529. gbvrt499.seq - Other vertebrate sequence entries, part 499. 7530. gbvrt5.seq - Other vertebrate sequence entries, part 5. 7531. gbvrt50.seq - Other vertebrate sequence entries, part 50. 7532. gbvrt500.seq - Other vertebrate sequence entries, part 500. 7533. gbvrt501.seq - Other vertebrate sequence entries, part 501. 7534. gbvrt502.seq - Other vertebrate sequence entries, part 502. 7535. gbvrt503.seq - Other vertebrate sequence entries, part 503. 7536. gbvrt504.seq - Other vertebrate sequence entries, part 504. 7537. gbvrt505.seq - Other vertebrate sequence entries, part 505. 7538. gbvrt506.seq - Other vertebrate sequence entries, part 506. 7539. gbvrt507.seq - Other vertebrate sequence entries, part 507. 7540. gbvrt508.seq - Other vertebrate sequence entries, part 508. 7541. gbvrt509.seq - Other vertebrate sequence entries, part 509. 7542. gbvrt51.seq - Other vertebrate sequence entries, part 51. 7543. gbvrt510.seq - Other vertebrate sequence entries, part 510. 7544. gbvrt511.seq - Other vertebrate sequence entries, part 511. 7545. gbvrt512.seq - Other vertebrate sequence entries, part 512. 7546. gbvrt513.seq - Other vertebrate sequence entries, part 513. 7547. gbvrt514.seq - Other vertebrate sequence entries, part 514. 7548. gbvrt515.seq - Other vertebrate sequence entries, part 515. 7549. gbvrt516.seq - Other vertebrate sequence entries, part 516. 7550. gbvrt517.seq - Other vertebrate sequence entries, part 517. 7551. gbvrt518.seq - Other vertebrate sequence entries, part 518. 7552. gbvrt519.seq - Other vertebrate sequence entries, part 519. 7553. gbvrt52.seq - Other vertebrate sequence entries, part 52. 7554. gbvrt520.seq - Other vertebrate sequence entries, part 520. 7555. gbvrt521.seq - Other vertebrate sequence entries, part 521. 7556. gbvrt522.seq - Other vertebrate sequence entries, part 522. 7557. gbvrt523.seq - Other vertebrate sequence entries, part 523. 7558. gbvrt524.seq - Other vertebrate sequence entries, part 524. 7559. gbvrt525.seq - Other vertebrate sequence entries, part 525. 7560. gbvrt526.seq - Other vertebrate sequence entries, part 526. 7561. gbvrt527.seq - Other vertebrate sequence entries, part 527. 7562. gbvrt528.seq - Other vertebrate sequence entries, part 528. 7563. gbvrt529.seq - Other vertebrate sequence entries, part 529. 7564. gbvrt53.seq - Other vertebrate sequence entries, part 53. 7565. gbvrt530.seq - Other vertebrate sequence entries, part 530. 7566. gbvrt531.seq - Other vertebrate sequence entries, part 531. 7567. gbvrt532.seq - Other vertebrate sequence entries, part 532. 7568. gbvrt533.seq - Other vertebrate sequence entries, part 533. 7569. gbvrt534.seq - Other vertebrate sequence entries, part 534. 7570. gbvrt535.seq - Other vertebrate sequence entries, part 535. 7571. gbvrt536.seq - Other vertebrate sequence entries, part 536. 7572. gbvrt537.seq - Other vertebrate sequence entries, part 537. 7573. gbvrt538.seq - Other vertebrate sequence entries, part 538. 7574. gbvrt539.seq - Other vertebrate sequence entries, part 539. 7575. gbvrt54.seq - Other vertebrate sequence entries, part 54. 7576. gbvrt540.seq - Other vertebrate sequence entries, part 540. 7577. gbvrt541.seq - Other vertebrate sequence entries, part 541. 7578. gbvrt542.seq - Other vertebrate sequence entries, part 542. 7579. gbvrt543.seq - Other vertebrate sequence entries, part 543. 7580. gbvrt544.seq - Other vertebrate sequence entries, part 544. 7581. gbvrt545.seq - Other vertebrate sequence entries, part 545. 7582. gbvrt546.seq - Other vertebrate sequence entries, part 546. 7583. gbvrt547.seq - Other vertebrate sequence entries, part 547. 7584. gbvrt548.seq - Other vertebrate sequence entries, part 548. 7585. gbvrt549.seq - Other vertebrate sequence entries, part 549. 7586. gbvrt55.seq - Other vertebrate sequence entries, part 55. 7587. gbvrt550.seq - Other vertebrate sequence entries, part 550. 7588. gbvrt551.seq - Other vertebrate sequence entries, part 551. 7589. gbvrt552.seq - Other vertebrate sequence entries, part 552. 7590. gbvrt553.seq - Other vertebrate sequence entries, part 553. 7591. gbvrt554.seq - Other vertebrate sequence entries, part 554. 7592. gbvrt555.seq - Other vertebrate sequence entries, part 555. 7593. gbvrt556.seq - Other vertebrate sequence entries, part 556. 7594. gbvrt557.seq - Other vertebrate sequence entries, part 557. 7595. gbvrt558.seq - Other vertebrate sequence entries, part 558. 7596. gbvrt559.seq - Other vertebrate sequence entries, part 559. 7597. gbvrt56.seq - Other vertebrate sequence entries, part 56. 7598. gbvrt560.seq - Other vertebrate sequence entries, part 560. 7599. gbvrt561.seq - Other vertebrate sequence entries, part 561. 7600. gbvrt562.seq - Other vertebrate sequence entries, part 562. 7601. gbvrt563.seq - Other vertebrate sequence entries, part 563. 7602. gbvrt564.seq - Other vertebrate sequence entries, part 564. 7603. gbvrt565.seq - Other vertebrate sequence entries, part 565. 7604. gbvrt566.seq - Other vertebrate sequence entries, part 566. 7605. gbvrt567.seq - Other vertebrate sequence entries, part 567. 7606. gbvrt568.seq - Other vertebrate sequence entries, part 568. 7607. gbvrt569.seq - Other vertebrate sequence entries, part 569. 7608. gbvrt57.seq - Other vertebrate sequence entries, part 57. 7609. gbvrt570.seq - Other vertebrate sequence entries, part 570. 7610. gbvrt571.seq - Other vertebrate sequence entries, part 571. 7611. gbvrt572.seq - Other vertebrate sequence entries, part 572. 7612. gbvrt573.seq - Other vertebrate sequence entries, part 573. 7613. gbvrt574.seq - Other vertebrate sequence entries, part 574. 7614. gbvrt575.seq - Other vertebrate sequence entries, part 575. 7615. gbvrt576.seq - Other vertebrate sequence entries, part 576. 7616. gbvrt577.seq - Other vertebrate sequence entries, part 577. 7617. gbvrt578.seq - Other vertebrate sequence entries, part 578. 7618. gbvrt579.seq - Other vertebrate sequence entries, part 579. 7619. gbvrt58.seq - Other vertebrate sequence entries, part 58. 7620. gbvrt580.seq - Other vertebrate sequence entries, part 580. 7621. gbvrt59.seq - Other vertebrate sequence entries, part 59. 7622. gbvrt6.seq - Other vertebrate sequence entries, part 6. 7623. gbvrt60.seq - Other vertebrate sequence entries, part 60. 7624. gbvrt61.seq - Other vertebrate sequence entries, part 61. 7625. gbvrt62.seq - Other vertebrate sequence entries, part 62. 7626. gbvrt63.seq - Other vertebrate sequence entries, part 63. 7627. gbvrt64.seq - Other vertebrate sequence entries, part 64. 7628. gbvrt65.seq - Other vertebrate sequence entries, part 65. 7629. gbvrt66.seq - Other vertebrate sequence entries, part 66. 7630. gbvrt67.seq - Other vertebrate sequence entries, part 67. 7631. gbvrt68.seq - Other vertebrate sequence entries, part 68. 7632. gbvrt69.seq - Other vertebrate sequence entries, part 69. 7633. gbvrt7.seq - Other vertebrate sequence entries, part 7. 7634. gbvrt70.seq - Other vertebrate sequence entries, part 70. 7635. gbvrt71.seq - Other vertebrate sequence entries, part 71. 7636. gbvrt72.seq - Other vertebrate sequence entries, part 72. 7637. gbvrt73.seq - Other vertebrate sequence entries, part 73. 7638. gbvrt74.seq - Other vertebrate sequence entries, part 74. 7639. gbvrt75.seq - Other vertebrate sequence entries, part 75. 7640. gbvrt76.seq - Other vertebrate sequence entries, part 76. 7641. gbvrt77.seq - Other vertebrate sequence entries, part 77. 7642. gbvrt78.seq - Other vertebrate sequence entries, part 78. 7643. gbvrt79.seq - Other vertebrate sequence entries, part 79. 7644. gbvrt8.seq - Other vertebrate sequence entries, part 8. 7645. gbvrt80.seq - Other vertebrate sequence entries, part 80. 7646. gbvrt81.seq - Other vertebrate sequence entries, part 81. 7647. gbvrt82.seq - Other vertebrate sequence entries, part 82. 7648. gbvrt83.seq - Other vertebrate sequence entries, part 83. 7649. gbvrt84.seq - Other vertebrate sequence entries, part 84. 7650. gbvrt85.seq - Other vertebrate sequence entries, part 85. 7651. gbvrt86.seq - Other vertebrate sequence entries, part 86. 7652. gbvrt87.seq - Other vertebrate sequence entries, part 87. 7653. gbvrt88.seq - Other vertebrate sequence entries, part 88. 7654. gbvrt89.seq - Other vertebrate sequence entries, part 89. 7655. gbvrt9.seq - Other vertebrate sequence entries, part 9. 7656. gbvrt90.seq - Other vertebrate sequence entries, part 90. 7657. gbvrt91.seq - Other vertebrate sequence entries, part 91. 7658. gbvrt92.seq - Other vertebrate sequence entries, part 92. 7659. gbvrt93.seq - Other vertebrate sequence entries, part 93. 7660. gbvrt94.seq - Other vertebrate sequence entries, part 94. 7661. gbvrt95.seq - Other vertebrate sequence entries, part 95. 7662. gbvrt96.seq - Other vertebrate sequence entries, part 96. 7663. gbvrt97.seq - Other vertebrate sequence entries, part 97. 7664. gbvrt98.seq - Other vertebrate sequence entries, part 98. 7665. gbvrt99.seq - Other vertebrate sequence entries, part 99. Sequences in the CON division data files (gbcon*.seq) are constructed from other "traditional" sequence records, and are represented in a unique way. CON records do not contain any sequence data; instead, they utilize a CONTIG linetype with a join() statement which describes how component sequences can be assembled to form the larger constructed sequence. Records in the CON division do not contribute to GenBank Release statistics (Sections 2.2.6, 2.2.7, and 2.2.8), or to the overall release statistics presented in the header of these release notes. The GenBank README describes the CON division of GenBank in more detail: ftp://ftp.ncbi.nih.gov/genbank/README.genbank 2.2.5 File Sizes Uncompressed, the Release 271.0 flatfiles require roughly 10334 GB, including the sequence files and the *.txt files. The following table contains the approximate sizes of the individual files in this release. Since minor changes to some of the files might have occurred after these release notes were written, these sizes should not be used to determine file integrity; they are provided as an aid to planning only. File Size File Name 1488889787 gbbct1.seq 1489333048 gbbct10.seq 1493592491 gbbct100.seq 1496902949 gbbct101.seq 1495761625 gbbct102.seq 1497775210 gbbct103.seq 1493901155 gbbct104.seq 1490033797 gbbct105.seq 1496318839 gbbct106.seq 1495648513 gbbct107.seq 1498954587 gbbct108.seq 1495660313 gbbct109.seq 1491808540 gbbct11.seq 1493480600 gbbct110.seq 1499904752 gbbct111.seq 1497730726 gbbct112.seq 1498397980 gbbct113.seq 1498199627 gbbct114.seq 1497939256 gbbct115.seq 1493977254 gbbct116.seq 1497654315 gbbct117.seq 1488645806 gbbct118.seq 1489768741 gbbct119.seq 1499767419 gbbct12.seq 1499969911 gbbct120.seq 1491639267 gbbct121.seq 1499715857 gbbct122.seq 1488848451 gbbct123.seq 1498119123 gbbct124.seq 1499549367 gbbct125.seq 1497183209 gbbct126.seq 1497830786 gbbct127.seq 1496598497 gbbct128.seq 1497031259 gbbct129.seq 1494547210 gbbct13.seq 1499373910 gbbct130.seq 1495815943 gbbct131.seq 1496778858 gbbct132.seq 1495331409 gbbct133.seq 1496835256 gbbct134.seq 1495265205 gbbct135.seq 1497931054 gbbct136.seq 1496246831 gbbct137.seq 1497506727 gbbct138.seq 1498017884 gbbct139.seq 1494589532 gbbct14.seq 1499780876 gbbct140.seq 1495303927 gbbct141.seq 1495208720 gbbct142.seq 1498457067 gbbct143.seq 1497971122 gbbct144.seq 1498414699 gbbct145.seq 1498233041 gbbct146.seq 1495521009 gbbct147.seq 1500000000 gbbct148.seq 1499859882 gbbct149.seq 1494164229 gbbct15.seq 1499514660 gbbct150.seq 1496893057 gbbct151.seq 1498741210 gbbct152.seq 1492975987 gbbct153.seq 1497036627 gbbct154.seq 1481972930 gbbct155.seq 1491098396 gbbct156.seq 1489305295 gbbct157.seq 1495557881 gbbct158.seq 1498974383 gbbct159.seq 1497878760 gbbct16.seq 1492382316 gbbct160.seq 1498001949 gbbct161.seq 1493959398 gbbct162.seq 1495840488 gbbct163.seq 1495309155 gbbct164.seq 1494972801 gbbct165.seq 1484351479 gbbct166.seq 1497538326 gbbct167.seq 1496001108 gbbct168.seq 1495934560 gbbct169.seq 1498082439 gbbct17.seq 1497291444 gbbct170.seq 1499778682 gbbct171.seq 1489929919 gbbct172.seq 1489651425 gbbct173.seq 1498572122 gbbct174.seq 1497702170 gbbct175.seq 1487476285 gbbct176.seq 1495588462 gbbct177.seq 1498387785 gbbct178.seq 1495086344 gbbct179.seq 1498337030 gbbct18.seq 1499522454 gbbct180.seq 1499994228 gbbct181.seq 1490248500 gbbct182.seq 1494591176 gbbct183.seq 1496989234 gbbct184.seq 1496634868 gbbct185.seq 1490890600 gbbct186.seq 1499500855 gbbct187.seq 1499724759 gbbct188.seq 1494966184 gbbct189.seq 1489319913 gbbct19.seq 1496153236 gbbct190.seq 1498443838 gbbct191.seq 1499899479 gbbct192.seq 1498328323 gbbct193.seq 1497411690 gbbct194.seq 1492106513 gbbct195.seq 1497171644 gbbct196.seq 1491813147 gbbct197.seq 1495956414 gbbct198.seq 1498205668 gbbct199.seq 1497069033 gbbct2.seq 1492335761 gbbct20.seq 1491516653 gbbct200.seq 1490813233 gbbct201.seq 1499424686 gbbct202.seq 1493396609 gbbct203.seq 1496004287 gbbct204.seq 1496621215 gbbct205.seq 1497099928 gbbct206.seq 1498472358 gbbct207.seq 1498061083 gbbct208.seq 1496718361 gbbct209.seq 1498749011 gbbct21.seq 1495415450 gbbct210.seq 1487752454 gbbct211.seq 1497152114 gbbct212.seq 1499567325 gbbct213.seq 1496035103 gbbct214.seq 1498944177 gbbct215.seq 1493942405 gbbct216.seq 1478889913 gbbct217.seq 1498210120 gbbct218.seq 1499310118 gbbct219.seq 1492991284 gbbct22.seq 1491360690 gbbct220.seq 1499344087 gbbct221.seq 1499673747 gbbct222.seq 1495986438 gbbct223.seq 1497077469 gbbct224.seq 1498496772 gbbct225.seq 1493640259 gbbct226.seq 1496310112 gbbct227.seq 1488907344 gbbct228.seq 1496788808 gbbct229.seq 1495786918 gbbct23.seq 1488386346 gbbct230.seq 1497541795 gbbct231.seq 1490680559 gbbct232.seq 1496142827 gbbct233.seq 1497378038 gbbct234.seq 1491662382 gbbct235.seq 1498366712 gbbct236.seq 1491631464 gbbct237.seq 1493771509 gbbct238.seq 1491301296 gbbct239.seq 1497573602 gbbct24.seq 1495163179 gbbct240.seq 1499004128 gbbct241.seq 1481156380 gbbct242.seq 1498438982 gbbct243.seq 1490058434 gbbct244.seq 1499255952 gbbct245.seq 1492371481 gbbct246.seq 1498152976 gbbct247.seq 1497910964 gbbct248.seq 1484501248 gbbct249.seq 1495362369 gbbct25.seq 1490457423 gbbct250.seq 1489513271 gbbct251.seq 1493678803 gbbct252.seq 1489798904 gbbct253.seq 1499208068 gbbct254.seq 1496803031 gbbct255.seq 1495747822 gbbct256.seq 1498679999 gbbct257.seq 1491728652 gbbct258.seq 1498534637 gbbct259.seq 1494666517 gbbct26.seq 1496000428 gbbct260.seq 1493762532 gbbct261.seq 1495660727 gbbct262.seq 1499772626 gbbct263.seq 1496606417 gbbct264.seq 1497135025 gbbct265.seq 1489747410 gbbct266.seq 1495676901 gbbct267.seq 1494885711 gbbct268.seq 1492344660 gbbct269.seq 1499996054 gbbct27.seq 1489980916 gbbct270.seq 1489199171 gbbct271.seq 1489789234 gbbct272.seq 1488636105 gbbct273.seq 1499221826 gbbct274.seq 1487173079 gbbct275.seq 1489010693 gbbct276.seq 1496572192 gbbct277.seq 1496607634 gbbct278.seq 1482257784 gbbct279.seq 1497898566 gbbct28.seq 1495939192 gbbct280.seq 1493039512 gbbct281.seq 1496750424 gbbct282.seq 1490223496 gbbct283.seq 1496202491 gbbct284.seq 1490831488 gbbct285.seq 1496196589 gbbct286.seq 1497573311 gbbct287.seq 1490292007 gbbct288.seq 1494388119 gbbct289.seq 1497953371 gbbct29.seq 1494518200 gbbct290.seq 1485580837 gbbct291.seq 1496144270 gbbct292.seq 1490852331 gbbct293.seq 1495241640 gbbct294.seq 1490029791 gbbct295.seq 1499901789 gbbct296.seq 1489247852 gbbct297.seq 1490024959 gbbct298.seq 1491637414 gbbct299.seq 1488295718 gbbct3.seq 1489803857 gbbct30.seq 1496093857 gbbct300.seq 1495424212 gbbct301.seq 1493330249 gbbct302.seq 1488743970 gbbct303.seq 1490320169 gbbct304.seq 1487444035 gbbct305.seq 1497140231 gbbct306.seq 1491979478 gbbct307.seq 1498968758 gbbct308.seq 1486189445 gbbct309.seq 1494359518 gbbct31.seq 1491089268 gbbct310.seq 1494606950 gbbct311.seq 1488668167 gbbct312.seq 1497597651 gbbct313.seq 1494289445 gbbct314.seq 1499452698 gbbct315.seq 1498151382 gbbct316.seq 1498572255 gbbct317.seq 1492785272 gbbct318.seq 1499688518 gbbct319.seq 1496199445 gbbct32.seq 1497897259 gbbct320.seq 1487775210 gbbct321.seq 1499689452 gbbct322.seq 1494884080 gbbct323.seq 1494620672 gbbct324.seq 1497449468 gbbct325.seq 1497284051 gbbct326.seq 1494381450 gbbct327.seq 1489646159 gbbct328.seq 1499431489 gbbct329.seq 1498376277 gbbct33.seq 1495296893 gbbct330.seq 1492485949 gbbct331.seq 1496299020 gbbct332.seq 1490770100 gbbct333.seq 1495069815 gbbct334.seq 1496388239 gbbct335.seq 1491920882 gbbct336.seq 1499767732 gbbct337.seq 1486703353 gbbct338.seq 1499401489 gbbct339.seq 1494403205 gbbct34.seq 1489493288 gbbct340.seq 1493806931 gbbct341.seq 1499875662 gbbct342.seq 1489635519 gbbct343.seq 1484870023 gbbct344.seq 1496007174 gbbct345.seq 1488086911 gbbct346.seq 1491189611 gbbct347.seq 1491483307 gbbct348.seq 1496744217 gbbct349.seq 1497382157 gbbct35.seq 1493734380 gbbct350.seq 1491683318 gbbct351.seq 1496321347 gbbct352.seq 1499456892 gbbct353.seq 1487718184 gbbct354.seq 1496872378 gbbct355.seq 1495699857 gbbct356.seq 1497247542 gbbct357.seq 1494997807 gbbct358.seq 1499041161 gbbct359.seq 1491800926 gbbct36.seq 1493341522 gbbct360.seq 1494701568 gbbct361.seq 1492311107 gbbct362.seq 1476126754 gbbct363.seq 1497907213 gbbct364.seq 1493975326 gbbct365.seq 1494474133 gbbct366.seq 1492451856 gbbct367.seq 1499375116 gbbct368.seq 1493390713 gbbct369.seq 1499613983 gbbct37.seq 1491996859 gbbct370.seq 1488831856 gbbct371.seq 1491758856 gbbct372.seq 1497641229 gbbct373.seq 1496574588 gbbct374.seq 1495032224 gbbct375.seq 1495950527 gbbct376.seq 1494824016 gbbct377.seq 1497703759 gbbct378.seq 1495436177 gbbct379.seq 1490960009 gbbct38.seq 1498075199 gbbct380.seq 1498692934 gbbct381.seq 1497595883 gbbct382.seq 1499969517 gbbct383.seq 1495795812 gbbct384.seq 1499644610 gbbct385.seq 1489988095 gbbct386.seq 1498489109 gbbct387.seq 1487315369 gbbct388.seq 1489566561 gbbct389.seq 1485326009 gbbct39.seq 1489727601 gbbct390.seq 1495209353 gbbct391.seq 1498468722 gbbct392.seq 1496265780 gbbct393.seq 1497453272 gbbct394.seq 1498762723 gbbct395.seq 1488793495 gbbct396.seq 1491404421 gbbct397.seq 1499733363 gbbct398.seq 1499124962 gbbct399.seq 1488723115 gbbct4.seq 1498822551 gbbct40.seq 1496254852 gbbct400.seq 1499998270 gbbct401.seq 1492215006 gbbct402.seq 1497873709 gbbct403.seq 1499365904 gbbct404.seq 1499091866 gbbct405.seq 1495117616 gbbct406.seq 1494930079 gbbct407.seq 1499047315 gbbct408.seq 1491486774 gbbct409.seq 1492536258 gbbct41.seq 1494978162 gbbct410.seq 1497900224 gbbct411.seq 1487509326 gbbct412.seq 1492050391 gbbct413.seq 1498332556 gbbct414.seq 1499998435 gbbct415.seq 1492148073 gbbct416.seq 1495555143 gbbct417.seq 1498925244 gbbct418.seq 1493433912 gbbct419.seq 1499432054 gbbct42.seq 1494388168 gbbct420.seq 1499064576 gbbct421.seq 1487482523 gbbct422.seq 1498620000 gbbct423.seq 1498720510 gbbct424.seq 1496552279 gbbct425.seq 1496344219 gbbct426.seq 1490561096 gbbct427.seq 1488543044 gbbct428.seq 1494900844 gbbct429.seq 1499136137 gbbct43.seq 1487247128 gbbct430.seq 1495378746 gbbct431.seq 1496490659 gbbct432.seq 1497800303 gbbct433.seq 1499912418 gbbct434.seq 1493219551 gbbct435.seq 1496167476 gbbct436.seq 1497802156 gbbct437.seq 1489130510 gbbct438.seq 1495041240 gbbct439.seq 1493914578 gbbct44.seq 1493064922 gbbct440.seq 1490136694 gbbct441.seq 1493265416 gbbct442.seq 1486615381 gbbct443.seq 1491920900 gbbct444.seq 1493070456 gbbct445.seq 1470856076 gbbct446.seq 1491682427 gbbct447.seq 1495086353 gbbct448.seq 1488872458 gbbct449.seq 1493395093 gbbct45.seq 1494857811 gbbct450.seq 1495783174 gbbct451.seq 1498720464 gbbct452.seq 1491936637 gbbct453.seq 1499484068 gbbct454.seq 1497766316 gbbct455.seq 1494477593 gbbct456.seq 1488576301 gbbct457.seq 1485913195 gbbct458.seq 1491765568 gbbct459.seq 1497760430 gbbct46.seq 1499946324 gbbct460.seq 1497937114 gbbct461.seq 1493586441 gbbct462.seq 1496880807 gbbct463.seq 1485725123 gbbct464.seq 1486568501 gbbct465.seq 1494126242 gbbct466.seq 1495628549 gbbct467.seq 1494347662 gbbct468.seq 1499998013 gbbct469.seq 1494554493 gbbct47.seq 1499998352 gbbct470.seq 1498505308 gbbct471.seq 1494233039 gbbct472.seq 1494351012 gbbct473.seq 1499943426 gbbct474.seq 1499364670 gbbct475.seq 1494405311 gbbct476.seq 1498028825 gbbct477.seq 1499030706 gbbct478.seq 1493866874 gbbct479.seq 1498699919 gbbct48.seq 1498125729 gbbct480.seq 1497769900 gbbct481.seq 1498999528 gbbct482.seq 1499999698 gbbct483.seq 1499927857 gbbct484.seq 1499999349 gbbct485.seq 1499999003 gbbct486.seq 1495724312 gbbct487.seq 1490161863 gbbct488.seq 1489610308 gbbct489.seq 1493248795 gbbct49.seq 1496548866 gbbct490.seq 1494646488 gbbct491.seq 1489890349 gbbct492.seq 1493795140 gbbct493.seq 1495896823 gbbct494.seq 1494155536 gbbct495.seq 1497993950 gbbct496.seq 1495445459 gbbct497.seq 1493827868 gbbct498.seq 1490998121 gbbct499.seq 1496619961 gbbct5.seq 1495527037 gbbct50.seq 1491899957 gbbct500.seq 1498942161 gbbct501.seq 1499998263 gbbct502.seq 1151443984 gbbct503.seq 1494565549 gbbct51.seq 1496982930 gbbct52.seq 1490016268 gbbct53.seq 1495175043 gbbct54.seq 1494330186 gbbct55.seq 1499122046 gbbct56.seq 1488411984 gbbct57.seq 1493083360 gbbct58.seq 1493162653 gbbct59.seq 1492861342 gbbct6.seq 1494412114 gbbct60.seq 1498820412 gbbct61.seq 1497419495 gbbct62.seq 1495227206 gbbct63.seq 1497836263 gbbct64.seq 1492530536 gbbct65.seq 1482798676 gbbct66.seq 1497198471 gbbct67.seq 1498569505 gbbct68.seq 1488701245 gbbct69.seq 1495463602 gbbct7.seq 1499971124 gbbct70.seq 1499537897 gbbct71.seq 1496087490 gbbct72.seq 1498807866 gbbct73.seq 1496453851 gbbct74.seq 1495734173 gbbct75.seq 1495132739 gbbct76.seq 1495360032 gbbct77.seq 1489200145 gbbct78.seq 1498062583 gbbct79.seq 1492413920 gbbct8.seq 1497139489 gbbct80.seq 1497942707 gbbct81.seq 1492481063 gbbct82.seq 1496846846 gbbct83.seq 1494683906 gbbct84.seq 1498479600 gbbct85.seq 1499057719 gbbct86.seq 1498221146 gbbct87.seq 1498105425 gbbct88.seq 1499560826 gbbct89.seq 1496465615 gbbct9.seq 1493727339 gbbct90.seq 1494694928 gbbct91.seq 1497604790 gbbct92.seq 1487888894 gbbct93.seq 1491180636 gbbct94.seq 1499923686 gbbct95.seq 1499903171 gbbct96.seq 1495614544 gbbct97.seq 1491486665 gbbct98.seq 1494509054 gbbct99.seq 700838 gbchg.txt 1499999969 gbcon1.seq 1499998041 gbcon10.seq 1499999537 gbcon11.seq 1499997924 gbcon12.seq 1499997679 gbcon13.seq 1499997430 gbcon14.seq 1499995609 gbcon15.seq 1499999879 gbcon16.seq 1499997237 gbcon17.seq 1499995112 gbcon18.seq 1499998661 gbcon19.seq 1498504524 gbcon2.seq 1499994850 gbcon20.seq 1499998669 gbcon21.seq 1499997805 gbcon22.seq 1499962284 gbcon23.seq 1499955309 gbcon24.seq 1499923847 gbcon25.seq 1500000182 gbcon26.seq 1499998325 gbcon27.seq 1499872928 gbcon28.seq 1500000226 gbcon29.seq 1499891031 gbcon3.seq 1499997940 gbcon30.seq 1500000148 gbcon31.seq 1499998034 gbcon32.seq 1499996052 gbcon33.seq 1499994024 gbcon34.seq 1500000012 gbcon35.seq 1499997100 gbcon36.seq 1499971212 gbcon37.seq 1500000057 gbcon38.seq 1499998568 gbcon39.seq 1495186233 gbcon4.seq 1500000059 gbcon40.seq 1499999568 gbcon41.seq 1499999810 gbcon42.seq 1499994374 gbcon43.seq 1499995677 gbcon44.seq 1499994660 gbcon45.seq 1499997313 gbcon46.seq 1499996676 gbcon47.seq 1499994346 gbcon48.seq 1499320529 gbcon49.seq 1491800558 gbcon5.seq 1499998493 gbcon50.seq 1499999379 gbcon51.seq 1499989681 gbcon52.seq 1499997309 gbcon53.seq 1499997049 gbcon54.seq 1499997298 gbcon55.seq 1499997552 gbcon56.seq 1499999697 gbcon57.seq 1499978001 gbcon58.seq 1499998547 gbcon59.seq 1499065022 gbcon6.seq 1499903864 gbcon60.seq 1499923620 gbcon61.seq 1499491760 gbcon62.seq 1499940563 gbcon63.seq 1499937072 gbcon64.seq 1499999178 gbcon65.seq 1499993203 gbcon66.seq 1499897023 gbcon67.seq 1426247016 gbcon68.seq 16504 gbcon69.seq (Patched to con68) 1499997078 gbcon7.seq 1499998636 gbcon8.seq 1499745026 gbcon9.seq 28456 gbdel.txt 1488248634 gbenv1.seq 1500000059 gbenv10.seq 1499997127 gbenv11.seq 1499997426 gbenv12.seq 1499998595 gbenv13.seq 1499999455 gbenv14.seq 1499998849 gbenv15.seq 1499997341 gbenv16.seq 1499998803 gbenv17.seq 1500000043 gbenv18.seq 1499998760 gbenv19.seq 1493525092 gbenv2.seq 1499991971 gbenv20.seq 1499998399 gbenv21.seq 1499996723 gbenv22.seq 1499999031 gbenv23.seq 1499828163 gbenv24.seq 1496620366 gbenv25.seq 1494621590 gbenv26.seq 1496467120 gbenv27.seq 1495932560 gbenv28.seq 1499651010 gbenv29.seq 1497421709 gbenv3.seq 1498793625 gbenv30.seq 1494891738 gbenv31.seq 1499447301 gbenv32.seq 1494387349 gbenv33.seq 1499057121 gbenv34.seq 1496666762 gbenv35.seq 1497874350 gbenv36.seq 1498857444 gbenv37.seq 1499985910 gbenv38.seq 1496780034 gbenv39.seq 1499119290 gbenv4.seq 1499998354 gbenv40.seq 380626474 gbenv41.seq 1491932882 gbenv5.seq 1497221078 gbenv6.seq 1499998377 gbenv7.seq 1499998266 gbenv8.seq 1499999353 gbenv9.seq 1499997921 gbest1.seq 1499998157 gbest10.seq 1499998002 gbest100.seq 1499999750 gbest101.seq 1499998647 gbest102.seq 1499996666 gbest103.seq 1499997734 gbest104.seq 1499997722 gbest105.seq 1499999914 gbest106.seq 1499998044 gbest107.seq 1499999493 gbest108.seq 1499998631 gbest109.seq 1499999419 gbest11.seq 1499997868 gbest110.seq 1499996818 gbest111.seq 1499995174 gbest112.seq 1499998922 gbest113.seq 1499998219 gbest114.seq 1499998824 gbest115.seq 1499997274 gbest116.seq 1499997308 gbest117.seq 1499993956 gbest118.seq 1499999414 gbest119.seq 1499995822 gbest12.seq 1499998754 gbest120.seq 1499998612 gbest121.seq 1499997329 gbest122.seq 1499999388 gbest123.seq 1500000225 gbest124.seq 1499999844 gbest125.seq 1499997848 gbest126.seq 1500000217 gbest127.seq 1499998681 gbest128.seq 1499999592 gbest129.seq 1499998283 gbest13.seq 1499999292 gbest130.seq 1499998801 gbest131.seq 1499998642 gbest132.seq 1499999093 gbest133.seq 1500000232 gbest134.seq 1499999029 gbest135.seq 1499997677 gbest136.seq 1499999189 gbest137.seq 1499999629 gbest138.seq 1499995790 gbest139.seq 1500000215 gbest14.seq 1499998479 gbest140.seq 1499997105 gbest141.seq 1499999451 gbest142.seq 1499999716 gbest143.seq 1499998005 gbest144.seq 1499999655 gbest145.seq 1499999593 gbest146.seq 1499999683 gbest147.seq 1499999158 gbest148.seq 1499998536 gbest149.seq 1499998418 gbest15.seq 1499999635 gbest150.seq 1500000200 gbest151.seq 1499999135 gbest152.seq 1500000095 gbest153.seq 1500000167 gbest154.seq 1499999697 gbest155.seq 1499999268 gbest156.seq 1499999857 gbest157.seq 1500000119 gbest158.seq 1499999118 gbest159.seq 1499999474 gbest16.seq 1499998064 gbest160.seq 1499998319 gbest161.seq 1499999218 gbest162.seq 1499999147 gbest163.seq 579362315 gbest164.seq 1499998902 gbest17.seq 1499998340 gbest18.seq 1499996249 gbest19.seq 1499999431 gbest2.seq 1499997079 gbest20.seq 1499997470 gbest21.seq 1499998696 gbest22.seq 1499999391 gbest23.seq 1499999045 gbest24.seq 1499998848 gbest25.seq 1499997996 gbest26.seq 1499997878 gbest27.seq 1499998801 gbest28.seq 1499998828 gbest29.seq 1500000107 gbest3.seq 1499997571 gbest30.seq 1499998929 gbest31.seq 1499997988 gbest32.seq 1499998098 gbest33.seq 1499999919 gbest34.seq 1499998326 gbest35.seq 1499996192 gbest36.seq 1499994518 gbest37.seq 1499999651 gbest38.seq 1499999979 gbest39.seq 1499998112 gbest4.seq 1499998585 gbest40.seq 1499998064 gbest41.seq 1499997209 gbest42.seq 1499999248 gbest43.seq 1499998241 gbest44.seq 1499999653 gbest45.seq 1499996839 gbest46.seq 1499999109 gbest47.seq 1500000248 gbest48.seq 1499997494 gbest49.seq 1499997213 gbest5.seq 1499999886 gbest50.seq 1499998708 gbest51.seq 1499998551 gbest52.seq 1499997896 gbest53.seq 1499997937 gbest54.seq 1499998881 gbest55.seq 1499999471 gbest56.seq 1499996382 gbest57.seq 1500000038 gbest58.seq 1500000053 gbest59.seq 1499999134 gbest6.seq 1499997046 gbest60.seq 1499998975 gbest61.seq 1499998712 gbest62.seq 1499997691 gbest63.seq 1499997348 gbest64.seq 1499996737 gbest65.seq 1499997409 gbest66.seq 1499999061 gbest67.seq 1499998667 gbest68.seq 1499999353 gbest69.seq 1499999536 gbest7.seq 1499997407 gbest70.seq 1499999747 gbest71.seq 1499999129 gbest72.seq 1499998471 gbest73.seq 1499997982 gbest74.seq 1499997064 gbest75.seq 1499998886 gbest76.seq 1499999173 gbest77.seq 1499996972 gbest78.seq 1499997731 gbest79.seq 1499997389 gbest8.seq 1499999770 gbest80.seq 1499998188 gbest81.seq 1499999853 gbest82.seq 1499999980 gbest83.seq 1499997587 gbest84.seq 1500000137 gbest85.seq 1499999040 gbest86.seq 1499999222 gbest87.seq 1499998824 gbest88.seq 1499998839 gbest89.seq 1499998369 gbest9.seq 1500000193 gbest90.seq 1499998697 gbest91.seq 1499998249 gbest92.seq 1499999930 gbest93.seq 1500000190 gbest94.seq 1499998898 gbest95.seq 1499998918 gbest96.seq 1499998791 gbest97.seq 1499999386 gbest98.seq 1499998238 gbest99.seq 1499999624 gbgss1.seq 1499998986 gbgss10.seq 1499999388 gbgss11.seq 1500000247 gbgss12.seq 1499999024 gbgss13.seq 1499998846 gbgss14.seq 1499999024 gbgss15.seq 1499999450 gbgss16.seq 1499998838 gbgss17.seq 1499998758 gbgss18.seq 1499999449 gbgss19.seq 1499998491 gbgss2.seq 1499999074 gbgss20.seq 1499998421 gbgss21.seq 1499999562 gbgss22.seq 1499998301 gbgss23.seq 1499997761 gbgss24.seq 1499998959 gbgss25.seq 1499999852 gbgss26.seq 1499999625 gbgss27.seq 1499998353 gbgss28.seq 1499997960 gbgss29.seq 1499998263 gbgss3.seq 1499999160 gbgss30.seq 1499997913 gbgss31.seq 1499998916 gbgss32.seq 1499997039 gbgss33.seq 1499997879 gbgss34.seq 1499998852 gbgss35.seq 1500000136 gbgss36.seq 1499997989 gbgss37.seq 1500000087 gbgss38.seq 1499997114 gbgss39.seq 1499998719 gbgss4.seq 1499997238 gbgss40.seq 1499998280 gbgss41.seq 1499998001 gbgss42.seq 1499999918 gbgss43.seq 1499999327 gbgss44.seq 1499998954 gbgss45.seq 1499998806 gbgss46.seq 1499999278 gbgss47.seq 1499999615 gbgss48.seq 1499999721 gbgss49.seq 1500000208 gbgss5.seq 1499999363 gbgss50.seq 1499999929 gbgss51.seq 1500000093 gbgss52.seq 1499997555 gbgss53.seq 1499999151 gbgss54.seq 1499999280 gbgss55.seq 1499999766 gbgss56.seq 1499999732 gbgss57.seq 1499997474 gbgss58.seq 1499998823 gbgss59.seq 1500000155 gbgss6.seq 1500000246 gbgss60.seq 1499999877 gbgss61.seq 1499997807 gbgss62.seq 1499998338 gbgss63.seq 1499998475 gbgss64.seq 1499998474 gbgss65.seq 1500000033 gbgss66.seq 1499998612 gbgss67.seq 1499998712 gbgss68.seq 1499998626 gbgss69.seq 1499998721 gbgss7.seq 1499998217 gbgss70.seq 1499999563 gbgss71.seq 1499999598 gbgss72.seq 1499998596 gbgss73.seq 1499998690 gbgss74.seq 1499998134 gbgss75.seq 1499999887 gbgss76.seq 1499998546 gbgss77.seq 1499998680 gbgss78.seq 452376765 gbgss79.seq 1499998770 gbgss8.seq 1499997950 gbgss9.seq 1499996036 gbhtc1.seq 1499999324 gbhtc2.seq 487604159 gbhtc3.seq 1499970686 gbhtg1.seq 1499829050 gbhtg10.seq 1499873205 gbhtg11.seq 1499884908 gbhtg12.seq 1499865106 gbhtg13.seq 1499899203 gbhtg14.seq 1499836748 gbhtg15.seq 1499690859 gbhtg16.seq 1499782440 gbhtg17.seq 1499854798 gbhtg18.seq 1499893377 gbhtg19.seq 1499830411 gbhtg2.seq 1499945647 gbhtg20.seq 1499944451 gbhtg21.seq 1499865480 gbhtg22.seq 1499789921 gbhtg23.seq 1499905569 gbhtg24.seq 650088108 gbhtg25.seq 1499902231 gbhtg3.seq 1499865254 gbhtg4.seq 1499916236 gbhtg5.seq 1499781411 gbhtg6.seq 1499713912 gbhtg7.seq 1499984024 gbhtg8.seq 1499942661 gbhtg9.seq 1500000000 gbinv1.seq 1461840782 gbinv10.seq 1484723061 gbinv100.seq 1469308457 gbinv1000.se 1425481446 gbinv1001.se 1480826974 gbinv1002.se 1497284905 gbinv1003.se 1424397420 gbinv1004.se 1497513399 gbinv1005.se 1479959544 gbinv1006.se 1496934524 gbinv1007.se 1499563247 gbinv1008.se 1499862687 gbinv1009.se 1477959257 gbinv101.seq 1476819906 gbinv1010.se 1479922716 gbinv1011.se 1498249855 gbinv1012.se 1474219413 gbinv1013.se 1486564532 gbinv1014.se 1497936205 gbinv1015.se 1482863470 gbinv1016.se 1496481428 gbinv1017.se 1495804016 gbinv1018.se 1497704655 gbinv1019.se 1487907501 gbinv102.seq 1435297230 gbinv1020.se 1480297535 gbinv1021.se 1440549582 gbinv1022.se 1359602883 gbinv1023.se 1426066925 gbinv1024.se 1483939418 gbinv1025.se 1415029251 gbinv1026.se 1486566603 gbinv1027.se 1477057418 gbinv1028.se 1476635933 gbinv1029.se 1483335760 gbinv103.seq 1499307582 gbinv1030.se 1496002548 gbinv1031.se 1479641483 gbinv1032.se 1459647517 gbinv1033.se 1494702984 gbinv1034.se 1487949565 gbinv1035.se 1497800590 gbinv1036.se 1461242418 gbinv1037.se 1489870431 gbinv1038.se 1495884092 gbinv1039.se 1451005950 gbinv104.seq 1497540413 gbinv1040.se 1486197654 gbinv1041.se 1326922414 gbinv1042.se 1401752460 gbinv1043.se 1415394702 gbinv1044.se 1483656229 gbinv1045.se 1396699373 gbinv1046.se 1488975706 gbinv1047.se 1372993989 gbinv1048.se 1421687738 gbinv1049.se 1462961223 gbinv105.seq 1486289482 gbinv1050.se 1493511949 gbinv1051.se 1408375747 gbinv1052.se 1497759371 gbinv1053.se 1496282789 gbinv1054.se 1475293012 gbinv1055.se 1482143964 gbinv1056.se 1494061946 gbinv1057.se 1464114370 gbinv1058.se 1495974698 gbinv1059.se 1498175960 gbinv106.seq 1484152935 gbinv1060.se 1491026280 gbinv1061.se 1477903857 gbinv1062.se 1369259342 gbinv1063.se 1488428353 gbinv1064.se 1494389587 gbinv1065.se 1476395086 gbinv1066.se 1461001554 gbinv1067.se 1486064673 gbinv1068.se 1496403251 gbinv1069.se 1499495752 gbinv107.seq 1424680983 gbinv1070.se 1495145240 gbinv1071.se 1426266476 gbinv1072.se 1471557364 gbinv1073.se 1497583916 gbinv1074.se 1327955977 gbinv1075.se 1409661426 gbinv1076.se 1494949707 gbinv1077.se 1488814772 gbinv1078.se 1492061068 gbinv1079.se 1467152114 gbinv108.seq 1485571907 gbinv1080.se 1494680481 gbinv1081.se 1495516663 gbinv1082.se 1476912420 gbinv1083.se 1491484026 gbinv1084.se 1483135466 gbinv1085.se 1483754977 gbinv1086.se 1489668944 gbinv1087.se 327546674 gbinv1088.se 1643334397 gbinv1089.se 1488613079 gbinv109.seq 1640559275 gbinv1090.se 1497007454 gbinv1091.se 1472669410 gbinv1092.se 1257114488 gbinv1093.se 1158932125 gbinv1094.se 1091355196 gbinv1095.se 1482889800 gbinv1096.se 1494854446 gbinv1097.se 1495393792 gbinv1098.se 1495596370 gbinv1099.se 1326469324 gbinv11.seq 1492609313 gbinv110.seq 1478743656 gbinv1100.se 1479964443 gbinv1101.se 1212765581 gbinv1102.se 1264461979 gbinv1103.se 1472053163 gbinv1104.se 1483532093 gbinv1105.se 1485399397 gbinv1106.se 1434900731 gbinv1107.se 1403583746 gbinv1108.se 1490227316 gbinv1109.se 1491980294 gbinv111.seq 1317975738 gbinv1110.se 1496656117 gbinv1111.se 1491923940 gbinv1112.se 1481611223 gbinv1113.se 1464385896 gbinv1114.se 1461241851 gbinv1115.se 1419375364 gbinv1116.se 1414336778 gbinv1117.se 1351486974 gbinv1118.se 1461381661 gbinv1119.se 1451818846 gbinv112.seq 1265070008 gbinv1120.se 1251689262 gbinv1121.se 1370596003 gbinv1122.se 1415630556 gbinv1123.se 1498739889 gbinv1124.se 1481328324 gbinv1125.se 1494373166 gbinv1126.se 1493035269 gbinv1127.se 1474363569 gbinv1128.se 1476556003 gbinv1129.se 1495043246 gbinv113.seq 1475790671 gbinv1130.se 1495452829 gbinv1131.se 1411678513 gbinv1132.se 1465383095 gbinv1133.se 1471953172 gbinv1134.se 1497539317 gbinv1135.se 1460744856 gbinv1136.se 1389161958 gbinv1137.se 1473827110 gbinv1138.se 1417873120 gbinv1139.se 1496006987 gbinv114.seq 1456967310 gbinv1140.se 1493353917 gbinv1141.se 1487340261 gbinv1142.se 1498920960 gbinv1143.se 1416085385 gbinv1144.se 1358941388 gbinv1145.se 1338021870 gbinv1146.se 1489664367 gbinv1147.se 1492101693 gbinv1148.se 1492069045 gbinv1149.se 1499998855 gbinv115.seq 1461580706 gbinv1150.se 1457626485 gbinv1151.se 1477161991 gbinv1152.se 1276391698 gbinv1153.se 1489817886 gbinv1154.se 1396487626 gbinv1155.se 1481870175 gbinv1156.se 1429028367 gbinv1157.se 1466228010 gbinv1158.se 1471600488 gbinv1159.se 1499998564 gbinv116.seq 1409226111 gbinv1160.se 1496049558 gbinv1161.se 1497967128 gbinv1162.se 1496703581 gbinv1163.se 1376644879 gbinv1164.se 1475469470 gbinv1165.se 1474043641 gbinv1166.se 1497987715 gbinv1167.se 1400146863 gbinv1168.se 1496044125 gbinv1169.se 1499999851 gbinv117.seq 1495327329 gbinv1170.se 1466460474 gbinv1171.se 1496588366 gbinv1172.se 1474274291 gbinv1173.se 1496907453 gbinv1174.se 985314121 gbinv1175.se 1434685164 gbinv1176.se 1292746951 gbinv1177.se 1480856124 gbinv1178.se 1480114723 gbinv1179.se 1499984937 gbinv118.seq 1483222630 gbinv1180.se 1462341069 gbinv1181.se 1352164766 gbinv1182.se 1425694067 gbinv1183.se 1490637510 gbinv1184.se 1494985045 gbinv1185.se 1453592569 gbinv1186.se 1387208849 gbinv1187.se 1493940395 gbinv1188.se 1412111547 gbinv1189.se 1499951747 gbinv119.seq 1456169680 gbinv1190.se 1435567581 gbinv1191.se 1490556716 gbinv1192.se 1187659834 gbinv1193.se 1242523625 gbinv1194.se 1440893915 gbinv1195.se 1284339672 gbinv1196.se 1146228865 gbinv1197.se 1472627160 gbinv1198.se 1433155128 gbinv1199.se 1494953349 gbinv12.seq 1499984689 gbinv120.seq 1419596117 gbinv1200.se 1479407564 gbinv1201.se 1472462979 gbinv1202.se 1484773551 gbinv1203.se 1465030164 gbinv1204.se 1498377387 gbinv1205.se 1498993416 gbinv1206.se 1496038600 gbinv1207.se 1493049257 gbinv1208.se 1483457475 gbinv1209.se 1499892596 gbinv121.seq 1484971549 gbinv1210.se 1478426035 gbinv1211.se 1445780814 gbinv1212.se 1497267302 gbinv1213.se 1473441284 gbinv1214.se 1495675893 gbinv1215.se 1491092369 gbinv1216.se 1490692660 gbinv1217.se 1492227424 gbinv1218.se 1489704661 gbinv1219.se 1499902644 gbinv122.seq 1477678968 gbinv1220.se 1495809819 gbinv1221.se 1484491955 gbinv1222.se 1497219339 gbinv1223.se 1497260099 gbinv1224.se 1462688933 gbinv1225.se 1490478215 gbinv1226.se 1414507519 gbinv1227.se 1499199990 gbinv1228.se 1339194507 gbinv1229.se 1499778631 gbinv123.seq 1223168688 gbinv1230.se 1250481177 gbinv1231.se 1414999042 gbinv1232.se 1484810827 gbinv1233.se 1400266339 gbinv1234.se 1453500497 gbinv1235.se 1482630665 gbinv1236.se 1490215962 gbinv1237.se 1492642852 gbinv1238.se 1487623038 gbinv1239.se 1499999796 gbinv124.seq 1459429648 gbinv1240.se 1490890240 gbinv1241.se 1419772193 gbinv1242.se 1213680921 gbinv1243.se 1410877565 gbinv1244.se 1372759802 gbinv1245.se 1242719770 gbinv1246.se 1182452129 gbinv1247.se 1449157042 gbinv1248.se 906561905 gbinv1249.se 1499918096 gbinv125.seq 1482020344 gbinv1250.se 1499234261 gbinv1251.se 1494939410 gbinv1252.se 1474301362 gbinv1253.se 1485444250 gbinv1254.se 1383548190 gbinv1255.se 1405527493 gbinv1256.se 1449266329 gbinv1257.se 1496243121 gbinv1258.se 1437252914 gbinv1259.se 1499964212 gbinv126.seq 1491693242 gbinv1260.se 1483600827 gbinv1261.se 1482867879 gbinv1262.se 1455464013 gbinv1263.se 1497801835 gbinv1264.se 1447829471 gbinv1265.se 1439626299 gbinv1266.se 1429739603 gbinv1267.se 1420649812 gbinv1268.se 1443957232 gbinv1269.se 1499999609 gbinv127.seq 1476686726 gbinv1270.se 1483695481 gbinv1271.se 1463695568 gbinv1272.se 1434396244 gbinv1273.se 1498866916 gbinv1274.se 1499963616 gbinv1275.se 1494586357 gbinv1276.se 1498994832 gbinv1277.se 1497018291 gbinv1278.se 1492810894 gbinv1279.se 1499999298 gbinv128.seq 1498873133 gbinv1280.se 1368250529 gbinv1281.se 1471868125 gbinv1282.se 1474164934 gbinv1283.se 1374631845 gbinv1284.se 1471592933 gbinv1285.se 1416421392 gbinv1286.se 1464793508 gbinv1287.se 1464264212 gbinv1288.se 1466315603 gbinv1289.se 1499996974 gbinv129.seq 1421470335 gbinv1290.se 1433744259 gbinv1291.se 1484795064 gbinv1292.se 1486983466 gbinv1293.se 1489879814 gbinv1294.se 1471500117 gbinv1295.se 1466366500 gbinv1296.se 1463292343 gbinv1297.se 1337548478 gbinv1298.se 1261162099 gbinv1299.se 1472338394 gbinv13.seq 1499963950 gbinv130.seq 1265249700 gbinv1300.se 1495592813 gbinv1301.se 1476184385 gbinv1302.se 1480062041 gbinv1303.se 1205237415 gbinv1304.se 1225570775 gbinv1305.se 1291768794 gbinv1306.se 1454529996 gbinv1307.se 1495583776 gbinv1308.se 1479042655 gbinv1309.se 1499999243 gbinv131.seq 1170720444 gbinv1310.se 1135630213 gbinv1311.se 1311043730 gbinv1312.se 1499214130 gbinv1313.se 1382420319 gbinv1314.se 1459959143 gbinv1315.se 1471411126 gbinv1316.se 1489176693 gbinv1317.se 1497156142 gbinv1318.se 1498177796 gbinv1319.se 1499998685 gbinv132.seq 1489346065 gbinv1320.se 1461403697 gbinv1321.se 1442250592 gbinv1322.se 1418403916 gbinv1323.se 1491038162 gbinv1324.se 1473626946 gbinv1325.se 1455772194 gbinv1326.se 1443244511 gbinv1327.se 1494976404 gbinv1328.se 1489546067 gbinv1329.se 1499999815 gbinv133.seq 1471992342 gbinv1330.se 1473344847 gbinv1331.se 1455009201 gbinv1332.se 1480051483 gbinv1333.se 1456939607 gbinv1334.se 1498185318 gbinv1335.se 1479358980 gbinv1336.se 1476595257 gbinv1337.se 1498631525 gbinv1338.se 1430920394 gbinv1339.se 1499999501 gbinv134.seq 1492969248 gbinv1340.se 1406556504 gbinv1341.se 1437410770 gbinv1342.se 1490414035 gbinv1343.se 1457870121 gbinv1344.se 1488361024 gbinv1345.se 1497435531 gbinv1346.se 1457501774 gbinv1347.se 1489718358 gbinv1348.se 1468327791 gbinv1349.se 1493212134 gbinv135.seq 1469728569 gbinv1350.se 1488497424 gbinv1351.se 1499304514 gbinv1352.se 1494132691 gbinv1353.se 1489999655 gbinv1354.se 1495098119 gbinv1355.se 1147829592 gbinv1356.se 1379583056 gbinv1357.se 1434603235 gbinv1358.se 1489686227 gbinv1359.se 1314190603 gbinv136.seq 1471107223 gbinv1360.se 1476509298 gbinv1361.se 1463686543 gbinv1362.se 1492079311 gbinv1363.se 1462957277 gbinv1364.se 1495466393 gbinv1365.se 1496581323 gbinv1366.se 1479069609 gbinv1367.se 1462958192 gbinv1368.se 1495206680 gbinv1369.se 1394793075 gbinv137.seq 1481263026 gbinv1370.se 1493020348 gbinv1371.se 1456916164 gbinv1372.se 1483666713 gbinv1373.se 1464018357 gbinv1374.se 1468669831 gbinv1375.se 1492103956 gbinv1376.se 1477464849 gbinv1377.se 1498913025 gbinv1378.se 1485376093 gbinv1379.se 1496763126 gbinv138.seq 1475693789 gbinv1380.se 1434250217 gbinv1381.se 1431247948 gbinv1382.se 1474158692 gbinv1383.se 1499911143 gbinv1384.se 1494872780 gbinv1385.se 1150025438 gbinv1386.se 1496375002 gbinv1387.se 1497864720 gbinv1388.se 1396805489 gbinv1389.se 1474285824 gbinv139.seq 1492636309 gbinv1390.se 1475859037 gbinv1391.se 1471812780 gbinv1392.se 1483811831 gbinv1393.se 1493396812 gbinv1394.se 1481568916 gbinv1395.se 1474020425 gbinv1396.se 1498531632 gbinv1397.se 1440948069 gbinv1398.se 1449371869 gbinv1399.se 1433077922 gbinv14.seq 1453187883 gbinv140.seq 1488467350 gbinv1400.se 1449683352 gbinv1401.se 1478693438 gbinv1402.se 1463567391 gbinv1403.se 1187576733 gbinv1404.se 1494582396 gbinv1405.se 1456806232 gbinv1406.se 1491758394 gbinv1407.se 1478410777 gbinv1408.se 1487715236 gbinv1409.se 1497188637 gbinv141.seq 1415819698 gbinv1410.se 1481755248 gbinv1411.se 1486148089 gbinv1412.se 1487061057 gbinv1413.se 1486909093 gbinv1414.se 1169761770 gbinv1415.se 1333902291 gbinv1416.se 1487360041 gbinv1417.se 1478373172 gbinv1418.se 1498431451 gbinv1419.se 1440999719 gbinv142.seq 1480466767 gbinv1420.se 1491681510 gbinv1421.se 1496169337 gbinv1422.se 1383895500 gbinv1423.se 1496566584 gbinv1424.se 1446412627 gbinv1425.se 1459315685 gbinv1426.se 1490123603 gbinv1427.se 1484787894 gbinv1428.se 1440253510 gbinv1429.se 1485746988 gbinv143.seq 1492902769 gbinv1430.se 1491453439 gbinv1431.se 1499816125 gbinv1432.se 1493824333 gbinv1433.se 1488609304 gbinv1434.se 1452749951 gbinv1435.se 1464198084 gbinv1436.se 1425431443 gbinv1437.se 1433233169 gbinv1438.se 1487701131 gbinv1439.se 1486304234 gbinv144.seq 1208422767 gbinv1440.se 1442403849 gbinv1441.se 1473448302 gbinv1442.se 1490096919 gbinv1443.se 1491592998 gbinv1444.se 1458946118 gbinv1445.se 1314885748 gbinv1446.se 1417788200 gbinv1447.se 1474836627 gbinv1448.se 1481552895 gbinv1449.se 1492952200 gbinv145.seq 1480560330 gbinv1450.se 1362876802 gbinv1451.se 1428301082 gbinv1452.se 1464838378 gbinv1453.se 1314372460 gbinv1454.se 1485208127 gbinv1455.se 1481331972 gbinv1456.se 1490980907 gbinv1457.se 1459970545 gbinv1458.se 1432307753 gbinv1459.se 1481015895 gbinv146.seq 1491322271 gbinv1460.se 1482755563 gbinv1461.se 1494708389 gbinv1462.se 1408743583 gbinv1463.se 1482024357 gbinv1464.se 1490257646 gbinv1465.se 1477535414 gbinv1466.se 1490599783 gbinv1467.se 1492422676 gbinv1468.se 1472836335 gbinv1469.se 1480665131 gbinv147.seq 1431970107 gbinv1470.se 1300771891 gbinv1471.se 1246003091 gbinv1472.se 1317364168 gbinv1473.se 1344336225 gbinv1474.se 1430051009 gbinv1475.se 1434782926 gbinv1476.se 1499840327 gbinv1477.se 1453398139 gbinv1478.se 1334224873 gbinv1479.se 1489739264 gbinv148.seq 1481563827 gbinv1480.se 1489499562 gbinv1481.se 1413624708 gbinv1482.se 1407454489 gbinv1483.se 1499490078 gbinv1484.se 1437963593 gbinv1485.se 1367057021 gbinv1486.se 1408925870 gbinv1487.se 1492728474 gbinv1488.se 1481907988 gbinv1489.se 1457608379 gbinv149.seq 1487123550 gbinv1490.se 1282702526 gbinv1491.se 1460237952 gbinv1492.se 1357911386 gbinv1493.se 1228736123 gbinv1494.se 1249382821 gbinv1495.se 1317162578 gbinv1496.se 1312713349 gbinv1497.se 1368420822 gbinv1498.se 1352883495 gbinv1499.se 1488441352 gbinv15.seq 1478321598 gbinv150.seq 1360442826 gbinv1500.se 1326769478 gbinv1501.se 1463654226 gbinv1502.se 1478409562 gbinv1503.se 1394484009 gbinv1504.se 1486284950 gbinv1505.se 945621055 gbinv1506.se 1313511642 gbinv1507.se 1489201144 gbinv1508.se 1493782242 gbinv1509.se 1431875964 gbinv151.seq 1416211586 gbinv1510.se 1465412246 gbinv1511.se 1486679922 gbinv1512.se 1333321388 gbinv1513.se 1465567257 gbinv1514.se 1481676481 gbinv1515.se 1335261765 gbinv1516.se 1430965425 gbinv1517.se 1444654055 gbinv1518.se 1418053182 gbinv1519.se 1471522844 gbinv152.seq 1379215229 gbinv1520.se 1209006526 gbinv1521.se 1139771415 gbinv1522.se 863495334 gbinv1523.se 1279903486 gbinv1524.se 1211814812 gbinv1525.se 1080009521 gbinv1526.se 1461918969 gbinv1527.se 1491410487 gbinv1528.se 1304381521 gbinv1529.se 1399337112 gbinv153.seq 1364434089 gbinv1530.se 1456602444 gbinv1531.se 1430852439 gbinv1532.se 1428141256 gbinv1533.se 1402083098 gbinv1534.se 1486267856 gbinv1535.se 1465260914 gbinv1536.se 1459072706 gbinv1537.se 1388758323 gbinv1538.se 1341994841 gbinv1539.se 1475255930 gbinv154.seq 1409005197 gbinv1540.se 1364052809 gbinv1541.se 1490503812 gbinv1542.se 1497806726 gbinv1543.se 1360132342 gbinv1544.se 1480772249 gbinv1545.se 1457647818 gbinv1546.se 1477467655 gbinv1547.se 1069267697 gbinv1548.se 1180361110 gbinv1549.se 1462195183 gbinv155.seq 1366462631 gbinv1550.se 1482116180 gbinv1551.se 1479640199 gbinv1552.se 1457079396 gbinv1553.se 1371037901 gbinv1554.se 1496323017 gbinv1555.se 1493002919 gbinv1556.se 1447678667 gbinv1557.se 1497481072 gbinv1558.se 1196247016 gbinv1559.se 1434706475 gbinv156.seq 1464518435 gbinv1560.se 1498395423 gbinv1561.se 1490849673 gbinv1562.se 1336377333 gbinv1563.se 1381518323 gbinv1564.se 1423455136 gbinv1565.se 1463467322 gbinv1566.se 1360502783 gbinv1567.se 1466264932 gbinv1568.se 1493088318 gbinv1569.se 1373776798 gbinv157.seq 1266149921 gbinv1570.se 1405690618 gbinv1571.se 1486290288 gbinv1572.se 1496184053 gbinv1573.se 1499116099 gbinv1574.se 1490846947 gbinv1575.se 1490288648 gbinv1576.se 1495153842 gbinv1577.se 1483009617 gbinv1578.se 1441705591 gbinv1579.se 1489121333 gbinv158.seq 1492570359 gbinv1580.se 1478046780 gbinv1581.se 1471776164 gbinv1582.se 1459377048 gbinv1583.se 1445135977 gbinv1584.se 1469565906 gbinv1585.se 1478382242 gbinv1586.se 1403849817 gbinv1587.se 1494389256 gbinv1588.se 1312871590 gbinv1589.se 1486460238 gbinv159.seq 1444757689 gbinv1590.se 1475731684 gbinv1591.se 1212331775 gbinv1592.se 1334341989 gbinv1593.se 1489063008 gbinv1594.se 1484523220 gbinv1595.se 1488053211 gbinv1596.se 1377156934 gbinv1597.se 1425052492 gbinv1598.se 1497211930 gbinv1599.se 1500000114 gbinv16.seq 1496325855 gbinv160.seq 1491577455 gbinv1600.se 1490982075 gbinv1601.se 1482373675 gbinv1602.se 1477808743 gbinv1603.se 1490164212 gbinv1604.se 1496231726 gbinv1605.se 1471284777 gbinv1606.se 1473477017 gbinv1607.se 1489389383 gbinv1608.se 1499633787 gbinv1609.se 1499698580 gbinv161.seq 1287165017 gbinv1610.se 1488354629 gbinv1611.se 1447296635 gbinv1612.se 896981190 gbinv1613.se 1695495506 gbinv1614.se 1325273200 gbinv1615.se 950239534 gbinv1616.se 1349829845 gbinv1617.se 1167117668 gbinv1618.se 1436636151 gbinv1619.se 1492643398 gbinv162.seq 1367109616 gbinv1620.se 1496275197 gbinv1621.se 1499572475 gbinv1622.se 1480382491 gbinv1623.se 1495795226 gbinv1624.se 1454917762 gbinv1625.se 1319097655 gbinv1626.se 1482660857 gbinv1627.se 1492035331 gbinv1628.se 1484926606 gbinv1629.se 1476033355 gbinv163.seq 1391921127 gbinv1630.se 1487915633 gbinv1631.se 1345381782 gbinv1632.se 1382495496 gbinv1633.se 1443506232 gbinv1634.se 1481770668 gbinv1635.se 1436339021 gbinv1636.se 1494042163 gbinv1637.se 1493449601 gbinv1638.se 1465194349 gbinv1639.se 1492100172 gbinv164.seq 1485249682 gbinv1640.se 1392660379 gbinv1641.se 1462611516 gbinv1642.se 1380128971 gbinv1643.se 1405103312 gbinv1644.se 1463910761 gbinv1645.se 1296300202 gbinv1646.se 1480476765 gbinv1647.se 1489368094 gbinv1648.se 1468005185 gbinv1649.se 1485757001 gbinv165.seq 1318225822 gbinv1650.se 1364154815 gbinv1651.se 1499722880 gbinv1652.se 1360958686 gbinv1653.se 1467888662 gbinv1654.se 1472509591 gbinv1655.se 1487754512 gbinv1656.se 1439516144 gbinv1657.se 1487544404 gbinv1658.se 1453921053 gbinv1659.se 1478906901 gbinv166.seq 1499124078 gbinv1660.se 1495067388 gbinv1661.se 1456908878 gbinv1662.se 1484475376 gbinv1663.se 1304391226 gbinv1664.se 1473642550 gbinv1665.se 1494491791 gbinv1666.se 1497788023 gbinv1667.se 1488870776 gbinv1668.se 1411505930 gbinv1669.se 1467704314 gbinv167.seq 1430802709 gbinv1670.se 1168409196 gbinv1671.se 1484618423 gbinv1672.se 1486738222 gbinv1673.se 1446534670 gbinv1674.se 1497889205 gbinv1675.se 1424997922 gbinv1676.se 1451123008 gbinv1677.se 1467012715 gbinv1678.se 1495918581 gbinv1679.se 1458154799 gbinv168.seq 1486776168 gbinv1680.se 1454859759 gbinv1681.se 1474443897 gbinv1682.se 1488858303 gbinv1683.se 1495530599 gbinv1684.se 1466291543 gbinv1685.se 1491653233 gbinv1686.se 1488538645 gbinv1687.se 1486994027 gbinv1688.se 1388574281 gbinv1689.se 1395453814 gbinv169.seq 1417783750 gbinv1690.se 1491705420 gbinv1691.se 1484117896 gbinv1692.se 1309690332 gbinv1693.se 1454240920 gbinv1694.se 1473827684 gbinv1695.se 1467622223 gbinv1696.se 1497598483 gbinv1697.se 1485942694 gbinv1698.se 1484517958 gbinv1699.se 1486078057 gbinv17.seq 1477780276 gbinv170.seq 1498655673 gbinv1700.se 1227074224 gbinv1701.se 1454457045 gbinv1702.se 1492309333 gbinv1703.se 1448452485 gbinv1704.se 1423620173 gbinv1705.se 1464596914 gbinv1706.se 1496647785 gbinv1707.se 1447722569 gbinv1708.se 1483913193 gbinv1709.se 1494859422 gbinv171.seq 1317992116 gbinv1710.se 1479315262 gbinv1711.se 1475933032 gbinv1712.se 1377660834 gbinv1713.se 1476866566 gbinv1714.se 1496868241 gbinv1715.se 1496854099 gbinv1716.se 1455418810 gbinv1717.se 1334842368 gbinv1718.se 1494124365 gbinv1719.se 1489646792 gbinv172.seq 1483080635 gbinv1720.se 1475763048 gbinv1721.se 1498940662 gbinv1722.se 1497009684 gbinv1723.se 1475115359 gbinv1724.se 1491932901 gbinv1725.se 1491931291 gbinv1726.se 1370282350 gbinv1727.se 1487423098 gbinv1728.se 1499530030 gbinv1729.se 1478947378 gbinv173.seq 1346648665 gbinv1730.se 1349460506 gbinv1731.se 1403616057 gbinv1732.se 1301938726 gbinv1733.se 1491878666 gbinv1734.se 1439585445 gbinv1735.se 1495779143 gbinv1736.se 1454498399 gbinv1737.se 1489608482 gbinv1738.se 1477923419 gbinv1739.se 1302797072 gbinv174.seq 1200148229 gbinv1740.se 1228192944 gbinv1741.se 1433945706 gbinv1742.se 1498641371 gbinv1743.se 1472533783 gbinv1744.se 1373058412 gbinv1745.se 1464402233 gbinv1746.se 1496596100 gbinv1747.se 1490569102 gbinv1748.se 1362839273 gbinv1749.se 1451061108 gbinv175.seq 1341064923 gbinv1750.se 1498302817 gbinv1751.se 1475585119 gbinv1752.se 1446285087 gbinv1753.se 1426809261 gbinv1754.se 1499619785 gbinv1755.se 1494024759 gbinv1756.se 1337301671 gbinv1757.se 1409016564 gbinv1758.se 1498465929 gbinv1759.se 1433437455 gbinv176.seq 1498931048 gbinv1760.se 1472941609 gbinv1761.se 1425567563 gbinv1762.se 1440429860 gbinv1763.se 1230388853 gbinv1764.se 1272414845 gbinv1765.se 1453556185 gbinv1766.se 1326400015 gbinv1767.se 1484575247 gbinv1768.se 710316004 gbinv1769.se 1496797023 gbinv177.seq 1079611928 gbinv1770.se 1280161212 gbinv1771.se 1271710507 gbinv1772.se 1435548232 gbinv1773.se 256871957 gbinv1774.se 1486063021 gbinv1775.se 1429356159 gbinv1776.se 1462939559 gbinv1777.se 1422771123 gbinv1778.se 1457380428 gbinv1779.se 1490856362 gbinv178.seq 1484516863 gbinv1780.se 1495861727 gbinv1781.se 1489231451 gbinv1782.se 1495700528 gbinv1783.se 1471451149 gbinv1784.se 1477774986 gbinv1785.se 1497034545 gbinv1786.se 1492766922 gbinv1787.se 1381572521 gbinv1788.se 1494858560 gbinv1789.se 1499472377 gbinv179.seq 1448935638 gbinv1790.se 1484946653 gbinv1791.se 1462950303 gbinv1792.se 1497822111 gbinv1793.se 1466105261 gbinv1794.se 1407175194 gbinv1795.se 1324511511 gbinv1796.se 1143554949 gbinv1797.se 1488739381 gbinv1798.se 1413026274 gbinv1799.se 1491285959 gbinv18.seq 1496168206 gbinv180.seq 1499832615 gbinv1800.se 1488904576 gbinv1801.se 1496946934 gbinv1802.se 1487232703 gbinv1803.se 1487451752 gbinv1804.se 1470945223 gbinv1805.se 1463736314 gbinv1806.se 1466310508 gbinv1807.se 1465272571 gbinv1808.se 1485587254 gbinv1809.se 1484975120 gbinv181.seq 1487626317 gbinv1810.se 1485737652 gbinv1811.se 1492506609 gbinv1812.se 1406935910 gbinv1813.se 1462502046 gbinv1814.se 1484793427 gbinv1815.se 1497394090 gbinv1816.se 1492256453 gbinv1817.se 1495773286 gbinv1818.se 1499024278 gbinv1819.se 1434439581 gbinv182.seq 1466830197 gbinv1820.se 1350954964 gbinv1821.se 1373779987 gbinv1822.se 1465844944 gbinv1823.se 1603650629 gbinv1824.se 1494282235 gbinv1825.se 1332775561 gbinv1826.se 1271393990 gbinv1827.se 1107185584 gbinv1828.se 982483889 gbinv1829.se 1427781591 gbinv183.seq 882484658 gbinv1830.se 873844034 gbinv1831.se 1256361618 gbinv1832.se 612426066 gbinv1833.se 1601080336 gbinv1834.se 1469061914 gbinv1835.se 1325899258 gbinv1836.se 1261888776 gbinv1837.se 1100182242 gbinv1838.se 971065083 gbinv1839.se 1381540842 gbinv184.seq 874381159 gbinv1840.se 857629708 gbinv1841.se 1274109654 gbinv1842.se 1468169745 gbinv1843.se 1432525383 gbinv1844.se 1215664215 gbinv1845.se 1408772959 gbinv1846.se 1461727236 gbinv1847.se 1396342495 gbinv1848.se 1482711594 gbinv1849.se 1496331718 gbinv185.seq 1498502802 gbinv1850.se 1435022264 gbinv1851.se 1425466084 gbinv1852.se 1479857153 gbinv1853.se 1300594442 gbinv1854.se 1382904290 gbinv1855.se 1474553378 gbinv1856.se 1486089080 gbinv1857.se 1485704455 gbinv1858.se 1479839663 gbinv1859.se 1453899220 gbinv186.seq 1479006462 gbinv1860.se 1488235911 gbinv1861.se 1446523992 gbinv1862.se 1497047113 gbinv1863.se 1497886314 gbinv1864.se 1466036557 gbinv1865.se 1492070979 gbinv1866.se 1410228331 gbinv1867.se 1480772503 gbinv1868.se 1496360232 gbinv1869.se 1434618212 gbinv187.seq 1496958928 gbinv1870.se 1370613360 gbinv1871.se 1367913316 gbinv1872.se 1471070377 gbinv1873.se 1419608845 gbinv1874.se 1494246026 gbinv1875.se 1482043806 gbinv1876.se 1462501064 gbinv1877.se 1476457318 gbinv1878.se 1488099841 gbinv1879.se 1389319276 gbinv188.seq 1396597523 gbinv1880.se 1498935381 gbinv1881.se 1488457952 gbinv1882.se 1486157562 gbinv1883.se 913350689 gbinv1884.se 850574711 gbinv1885.se 1409850812 gbinv1886.se 1427241622 gbinv1887.se 1445506055 gbinv1888.se 1493757742 gbinv1889.se 1477534670 gbinv189.seq 1459170870 gbinv1890.se 1486061281 gbinv1891.se 1491435116 gbinv1892.se 1451903318 gbinv1893.se 1489264265 gbinv1894.se 1478220049 gbinv1895.se 1396971781 gbinv1896.se 1495187493 gbinv1897.se 1448054749 gbinv1898.se 1492733762 gbinv1899.se 1439676676 gbinv19.seq 1488412334 gbinv190.seq 1496471863 gbinv1900.se 1495085823 gbinv1901.se 1475044459 gbinv1902.se 1473435728 gbinv1903.se 1491659741 gbinv1904.se 1499386793 gbinv1905.se 1484193438 gbinv1906.se 1464113839 gbinv1907.se 1480056945 gbinv1908.se 1483923545 gbinv1909.se 1415598374 gbinv191.seq 1444226462 gbinv1910.se 1498531162 gbinv1911.se 1110894081 gbinv1912.se 1497333089 gbinv1913.se 902442087 gbinv1914.se 1294570564 gbinv1915.se 1341119737 gbinv1916.se 1487179968 gbinv1917.se 1479380110 gbinv1918.se 1497560249 gbinv1919.se 1492010009 gbinv192.seq 1427565104 gbinv1920.se 1466353029 gbinv1921.se 1499506110 gbinv1922.se 1476315631 gbinv1923.se 1477691874 gbinv1924.se 1485697338 gbinv1925.se 1486546937 gbinv1926.se 1476577085 gbinv1927.se 1496509822 gbinv1928.se 1487556099 gbinv1929.se 1490543765 gbinv193.seq 1483905128 gbinv1930.se 1498274411 gbinv1931.se 1415613184 gbinv1932.se 1495600907 gbinv1933.se 1484219627 gbinv1934.se 1405180070 gbinv1935.se 1472314780 gbinv1936.se 1446139256 gbinv1937.se 1481238150 gbinv1938.se 1482726585 gbinv1939.se 1474177025 gbinv194.seq 1416017823 gbinv1940.se 1496170833 gbinv1941.se 1406980282 gbinv1942.se 1481449275 gbinv1943.se 1229691246 gbinv1944.se 1359751003 gbinv1945.se 1409487002 gbinv1946.se 1464203778 gbinv1947.se 1407361011 gbinv1948.se 1449493536 gbinv1949.se 1497733597 gbinv195.seq 1309097005 gbinv1950.se 1423739726 gbinv1951.se 1018376509 gbinv1952.se 1466894721 gbinv1953.se 1423993513 gbinv1954.se 1490581232 gbinv1955.se 1485813165 gbinv1956.se 1462255017 gbinv1957.se 1334123854 gbinv1958.se 1417037001 gbinv1959.se 1488363204 gbinv196.seq 1489579302 gbinv1960.se 1465087418 gbinv1961.se 1466456046 gbinv1962.se 1426549792 gbinv1963.se 1489702447 gbinv1964.se 1279107615 gbinv1965.se 1427491154 gbinv1966.se 1456888696 gbinv1967.se 1438933728 gbinv1968.se 1473264078 gbinv1969.se 1322031976 gbinv197.seq 1319511653 gbinv1970.se 1454118383 gbinv1971.se 1359477650 gbinv1972.se 1433759704 gbinv1973.se 1488195366 gbinv1974.se 1494189364 gbinv1975.se 1349712667 gbinv1976.se 1435015351 gbinv1977.se 1421750158 gbinv1978.se 1397459222 gbinv1979.se 1036956058 gbinv198.seq 1456384886 gbinv1980.se 1362974288 gbinv1981.se 1362900968 gbinv1982.se 1421957137 gbinv1983.se 1490239908 gbinv1984.se 1495336800 gbinv1985.se 1489659702 gbinv1986.se 1442389320 gbinv1987.se 1497054887 gbinv1988.se 1489433389 gbinv1989.se 1495203360 gbinv199.seq 1454382137 gbinv1990.se 1478796321 gbinv1991.se 1480699740 gbinv1992.se 1478501658 gbinv1993.se 1372402964 gbinv1994.se 1482243960 gbinv1995.se 1486345309 gbinv1996.se 1332650794 gbinv1997.se 1429114016 gbinv1998.se 1299293645 gbinv1999.se 1487877023 gbinv2.seq 1492685748 gbinv20.seq 1447935102 gbinv200.seq 1463198524 gbinv2000.se 1373401117 gbinv2001.se 1379998498 gbinv2002.se 1449937173 gbinv2003.se 1463491452 gbinv2004.se 1472904594 gbinv2005.se 1496655387 gbinv2006.se 1479763708 gbinv2007.se 1490101686 gbinv2008.se 1489159140 gbinv2009.se 1384089696 gbinv201.seq 1485259401 gbinv2010.se 1263866797 gbinv2011.se 1358344195 gbinv2012.se 1476781519 gbinv2013.se 1337186023 gbinv2014.se 1497232816 gbinv2015.se 1412862419 gbinv2016.se 1498011478 gbinv2017.se 1334008470 gbinv2018.se 1498713177 gbinv2019.se 1486839094 gbinv202.seq 1492432004 gbinv2020.se 1497309298 gbinv2021.se 1486352593 gbinv2022.se 1456011753 gbinv2023.se 1438266016 gbinv2024.se 1477853681 gbinv2025.se 1378329184 gbinv2026.se 1491737917 gbinv2027.se 1479823205 gbinv2028.se 1460049559 gbinv2029.se 1491915479 gbinv203.seq 1471327971 gbinv2030.se 1343246899 gbinv2031.se 1436290689 gbinv2032.se 1421631693 gbinv2033.se 1481841105 gbinv2034.se 1481599588 gbinv2035.se 1395433443 gbinv2036.se 1206346599 gbinv2037.se 1024269054 gbinv2038.se 2385210404 gbinv2039.se 1468873166 gbinv204.seq 2220146238 gbinv2040.se 2187038933 gbinv2041.se 1421192470 gbinv2042.se 1475662350 gbinv2043.se 1445681402 gbinv2044.se 1454667816 gbinv2045.se 1471883702 gbinv2046.se 1489738171 gbinv2047.se 1451008891 gbinv2048.se 1486538835 gbinv2049.se 1463758806 gbinv205.seq 1346494857 gbinv2050.se 1495304690 gbinv2051.se 1491979855 gbinv2052.se 1462669981 gbinv2053.se 1456607760 gbinv2054.se 1382628833 gbinv2055.se 1434535716 gbinv2056.se 1498655806 gbinv2057.se 1499504565 gbinv2058.se 1487307583 gbinv2059.se 1489299330 gbinv206.seq 1442487816 gbinv2060.se 1463816877 gbinv2061.se 1477956584 gbinv2062.se 1488658797 gbinv2063.se 1479900925 gbinv2064.se 1496568873 gbinv2065.se 1352136912 gbinv2066.se 1452930692 gbinv2067.se 1325200511 gbinv2068.se 1281068844 gbinv2069.se 1474971021 gbinv207.seq 1182687607 gbinv2070.se 1493902753 gbinv2071.se 1391894385 gbinv2072.se 1288054858 gbinv2073.se 1085357780 gbinv2074.se 1482610491 gbinv2075.se 1491538487 gbinv2076.se 1482682447 gbinv2077.se 1498681662 gbinv2078.se 1457393574 gbinv2079.se 1480919022 gbinv208.seq 1273031330 gbinv2080.se 1278402461 gbinv2081.se 1406061489 gbinv2082.se 1438617726 gbinv2083.se 1422844818 gbinv2084.se 1424901855 gbinv2085.se 1489151978 gbinv2086.se 1494698953 gbinv2087.se 1489983539 gbinv2088.se 1464761210 gbinv2089.se 1499091818 gbinv209.seq 1405088346 gbinv2090.se 1486068081 gbinv2091.se 1389002062 gbinv2092.se 1444905820 gbinv2093.se 1398359348 gbinv2094.se 1461142739 gbinv2095.se 1461547013 gbinv2096.se 1497093606 gbinv2097.se 1416343895 gbinv2098.se 1437921198 gbinv2099.se 1494355902 gbinv21.seq 1470184038 gbinv210.seq 1335327033 gbinv2100.se 1414104436 gbinv2101.se 1435156917 gbinv2102.se 1454154644 gbinv2103.se 1499464931 gbinv2104.se 1474371587 gbinv2105.se 1486276305 gbinv2106.se 1387833138 gbinv2107.se 1420970198 gbinv2108.se 1437860703 gbinv2109.se 1418216803 gbinv211.seq 1408102339 gbinv2110.se 1466000992 gbinv2111.se 1413515241 gbinv2112.se 1417364930 gbinv2113.se 1495371444 gbinv2114.se 1450749451 gbinv2115.se 1435262025 gbinv2116.se 428311307 gbinv2117.se 1510350803 gbinv2118.se 1305167131 gbinv2119.se 1296171272 gbinv212.seq 922290560 gbinv2120.se 1394995521 gbinv2121.se 1317972846 gbinv2122.se 1296980597 gbinv2123.se 458723133 gbinv2124.se 1336263944 gbinv2125.se 1157816631 gbinv2126.se 1305053856 gbinv2127.se 1467539214 gbinv2128.se 1326763027 gbinv2129.se 1433436738 gbinv213.seq 1483995083 gbinv2130.se 1495397554 gbinv2131.se 1474988570 gbinv2132.se 1474022111 gbinv2133.se 1343173045 gbinv2134.se 1487791909 gbinv2135.se 1496954112 gbinv2136.se 1483284475 gbinv2137.se 1493710387 gbinv2138.se 1394690896 gbinv2139.se 1489239840 gbinv214.seq 1454859726 gbinv2140.se 1331755260 gbinv2141.se 1402140135 gbinv2142.se 1450423352 gbinv2143.se 1455301521 gbinv2144.se 1463291470 gbinv2145.se 1496767303 gbinv2146.se 1453312562 gbinv2147.se 1496496872 gbinv2148.se 1472027958 gbinv2149.se 1481320258 gbinv215.seq 1433321490 gbinv2150.se 1213877712 gbinv2151.se 1476347158 gbinv2152.se 1414098656 gbinv2153.se 1265817300 gbinv2154.se 1338368156 gbinv2155.se 1343308091 gbinv2156.se 1410260306 gbinv2157.se 1355574953 gbinv2158.se 1269847950 gbinv2159.se 1460371684 gbinv216.seq 1289480779 gbinv2160.se 1397568259 gbinv2161.se 1490630516 gbinv2162.se 1494732283 gbinv2163.se 1481391904 gbinv2164.se 1380669471 gbinv2165.se 1454851455 gbinv2166.se 572921207 gbinv2167.se 1401501082 gbinv2168.se 1320756439 gbinv2169.se 1499664512 gbinv217.seq 1228910448 gbinv2170.se 1097150810 gbinv2171.se 486185757 gbinv2172.se 1269374952 gbinv2173.se 1286905330 gbinv2174.se 1284017213 gbinv2175.se 1199156842 gbinv2176.se 1405471195 gbinv2177.se 853161944 gbinv2178.se 782360741 gbinv2179.se 1328138124 gbinv218.seq 1306452809 gbinv2180.se 1489111559 gbinv2181.se 1332035986 gbinv2182.se 1056795484 gbinv2183.se 849693808 gbinv2184.se 793427311 gbinv2185.se 1296722567 gbinv2186.se 1445109586 gbinv2187.se 1456859626 gbinv2188.se 1489168437 gbinv2189.se 1469015169 gbinv219.seq 359531109 gbinv2190.se 1557274808 gbinv2191.se 1445006590 gbinv2192.se 1425352552 gbinv2193.se 1358530617 gbinv2194.se 1210147610 gbinv2195.se 1128992271 gbinv2196.se 1126403933 gbinv2197.se 1498952274 gbinv2198.se 1423793952 gbinv2199.se 1411212874 gbinv22.seq 1353502339 gbinv220.seq 1460739782 gbinv2200.se 1407115448 gbinv2201.se 1498803289 gbinv2202.se 1397365803 gbinv2203.se 1483695103 gbinv2204.se 1425780648 gbinv2205.se 1494502598 gbinv2206.se 1480732936 gbinv2207.se 1495395684 gbinv2208.se 1468714870 gbinv2209.se 1391454867 gbinv221.seq 1462036642 gbinv2210.se 1458038918 gbinv2211.se 1485481684 gbinv2212.se 1486340552 gbinv2213.se 1468811816 gbinv2214.se 1497345328 gbinv2215.se 1436096674 gbinv2216.se 1320294840 gbinv2217.se 1492286064 gbinv2218.se 1487686801 gbinv2219.se 1455445962 gbinv222.seq 1436245168 gbinv2220.se 1333614671 gbinv2221.se 1495103788 gbinv2222.se 1226379015 gbinv2223.se 1487908906 gbinv2224.se 1430212901 gbinv2225.se 1490893302 gbinv2226.se 1271081449 gbinv2227.se 969964515 gbinv2228.se 929257355 gbinv2229.se 1107685205 gbinv223.seq 775431451 gbinv2230.se 1480042266 gbinv2231.se 1304441971 gbinv2232.se 1072949657 gbinv2233.se 1618361483 gbinv2234.se 1342603179 gbinv2235.se 983638357 gbinv2236.se 1322714924 gbinv2237.se 1071900590 gbinv2238.se 1382948710 gbinv2239.se 1394090305 gbinv224.seq 1443619225 gbinv2240.se 1382482160 gbinv2241.se 1202056738 gbinv2242.se 1306765557 gbinv2243.se 1490885745 gbinv2244.se 1473486240 gbinv2245.se 1479087448 gbinv2246.se 1458861254 gbinv2247.se 1464674026 gbinv2248.se 1466605001 gbinv2249.se 1480026370 gbinv225.seq 1445561284 gbinv2250.se 1290400701 gbinv2251.se 1444641928 gbinv2252.se 1212827698 gbinv2253.se 1311685176 gbinv2254.se 1475820076 gbinv2255.se 1478241692 gbinv2256.se 1362347952 gbinv2257.se 1419642000 gbinv2258.se 1309622700 gbinv2259.se 1448060159 gbinv226.seq 1374336485 gbinv2260.se 1323873105 gbinv2261.se 1387135360 gbinv2262.se 1481140431 gbinv2263.se 1192445291 gbinv2264.se 1380402477 gbinv2265.se 1447183292 gbinv2266.se 1488833837 gbinv2267.se 1315448660 gbinv2268.se 1255150749 gbinv2269.se 1490842623 gbinv227.seq 1489649703 gbinv2270.se 1495584466 gbinv2271.se 1496179742 gbinv2272.se 1499678015 gbinv2273.se 1381856262 gbinv2274.se 1498346158 gbinv2275.se 1495086254 gbinv2276.se 1491555927 gbinv2277.se 1242239737 gbinv2278.se 1476024450 gbinv2279.se 1411536136 gbinv228.seq 1324514672 gbinv2280.se 1397580302 gbinv2281.se 1494222785 gbinv2282.se 1482524711 gbinv2283.se 1186944153 gbinv2284.se 1329488290 gbinv2285.se 1495154330 gbinv2286.se 1493704361 gbinv2287.se 1450944183 gbinv2288.se 1483164278 gbinv2289.se 1494139979 gbinv229.seq 1498928099 gbinv2290.se 1372488681 gbinv2291.se 1196518649 gbinv2292.se 1356784120 gbinv2293.se 1468217533 gbinv2294.se 1445052621 gbinv2295.se 1396282294 gbinv2296.se 1480756545 gbinv2297.se 1419879298 gbinv2298.se 1332808631 gbinv2299.se 1479503556 gbinv23.seq 1489227769 gbinv230.seq 1461611760 gbinv2300.se 1480019648 gbinv2301.se 1450370064 gbinv2302.se 1241242474 gbinv2303.se 1499990341 gbinv2304.se 1499992976 gbinv2305.se 602428164 gbinv2306.se 1496825051 gbinv231.seq 1459836508 gbinv232.seq 1486479697 gbinv233.seq 1434617914 gbinv234.seq 1480403166 gbinv235.seq 1490419332 gbinv236.seq 1445334103 gbinv237.seq 1469205771 gbinv238.seq 1469528228 gbinv239.seq 1467267944 gbinv24.seq 1493019783 gbinv240.seq 1472750137 gbinv241.seq 1449037838 gbinv242.seq 1410920968 gbinv243.seq 1401579907 gbinv244.seq 1499507843 gbinv245.seq 1469963936 gbinv246.seq 1383512761 gbinv247.seq 1489112074 gbinv248.seq 1317128910 gbinv249.seq 1495185998 gbinv25.seq 1425982644 gbinv250.seq 1407898734 gbinv251.seq 1482815589 gbinv252.seq 1380702137 gbinv253.seq 1448208617 gbinv254.seq 1401389143 gbinv255.seq 1373347375 gbinv256.seq 1421317015 gbinv257.seq 1465852118 gbinv258.seq 1480689859 gbinv259.seq 1479452217 gbinv26.seq 1350089773 gbinv260.seq 1369868263 gbinv261.seq 1495958928 gbinv262.seq 1330078340 gbinv263.seq 1499457117 gbinv264.seq 1424785424 gbinv265.seq 1460890764 gbinv266.seq 1498719909 gbinv267.seq 1467866270 gbinv268.seq 1454749088 gbinv269.seq 1379912339 gbinv27.seq 1483735007 gbinv270.seq 1423383631 gbinv271.seq 1442141266 gbinv272.seq 1447797615 gbinv273.seq 1415062510 gbinv274.seq 1288745131 gbinv275.seq 1298703807 gbinv276.seq 1499332945 gbinv277.seq 1445909647 gbinv278.seq 1495821117 gbinv279.seq 1438841939 gbinv28.seq 1443202585 gbinv280.seq 1480225589 gbinv281.seq 1442908071 gbinv282.seq 1478166345 gbinv283.seq 1489195348 gbinv284.seq 1480031166 gbinv285.seq 1499676154 gbinv286.seq 1485192064 gbinv287.seq 1372921321 gbinv288.seq 1416726958 gbinv289.seq 1473739282 gbinv29.seq 1447728294 gbinv290.seq 1439652819 gbinv291.seq 1442618626 gbinv292.seq 1426894153 gbinv293.seq 1447226340 gbinv294.seq 1487195331 gbinv295.seq 1483792235 gbinv296.seq 1490454343 gbinv297.seq 1383487774 gbinv298.seq 1488575579 gbinv299.seq 1496070030 gbinv3.seq 1465777952 gbinv30.seq 1495179183 gbinv300.seq 1464715247 gbinv301.seq 1493913805 gbinv302.seq 1489979875 gbinv303.seq 1427512355 gbinv304.seq 1457194355 gbinv305.seq 1489488747 gbinv306.seq 1495947464 gbinv307.seq 1325794030 gbinv308.seq 1494136720 gbinv309.seq 1481220003 gbinv31.seq 1477159575 gbinv310.seq 1467829201 gbinv311.seq 1454855814 gbinv312.seq 1493852374 gbinv313.seq 1498242095 gbinv314.seq 1450415736 gbinv315.seq 1474891878 gbinv316.seq 1470758742 gbinv317.seq 1495937980 gbinv318.seq 623335680 gbinv319.seq 1498623648 gbinv32.seq 2729769834 gbinv320.seq 1951209797 gbinv321.seq 1255792905 gbinv322.seq 898357564 gbinv323.seq 1390359247 gbinv324.seq 1466020132 gbinv325.seq 1443272573 gbinv326.seq 1475387842 gbinv327.seq 1497205510 gbinv328.seq 1467101040 gbinv329.seq 1463401419 gbinv33.seq 1496389311 gbinv330.seq 1499117653 gbinv331.seq 1462931194 gbinv332.seq 1487873504 gbinv333.seq 1277578160 gbinv334.seq 1487639321 gbinv335.seq 1456188446 gbinv336.seq 1499002056 gbinv337.seq 1480066049 gbinv338.seq 1454211592 gbinv339.seq 1486087079 gbinv34.seq 1222756177 gbinv340.seq 1477554828 gbinv341.seq 1486108915 gbinv342.seq 1427447559 gbinv343.seq 1483162232 gbinv344.seq 1485243570 gbinv345.seq 1410776048 gbinv346.seq 1475127917 gbinv347.seq 1479038418 gbinv348.seq 1425853319 gbinv349.seq 1127234708 gbinv35.seq 1481373985 gbinv350.seq 1490243709 gbinv351.seq 1483879799 gbinv352.seq 1414434060 gbinv353.seq 1457292205 gbinv354.seq 1477018477 gbinv355.seq 1409025156 gbinv356.seq 1474794456 gbinv357.seq 1494012052 gbinv358.seq 1465696815 gbinv359.seq 1278053548 gbinv36.seq 1494483077 gbinv360.seq 1459440397 gbinv361.seq 1494957101 gbinv362.seq 1491910109 gbinv363.seq 1481624627 gbinv364.seq 1479042031 gbinv365.seq 1495864236 gbinv366.seq 1479577884 gbinv367.seq 1494515876 gbinv368.seq 1364399555 gbinv369.seq 1492952945 gbinv37.seq 1448613839 gbinv370.seq 1492450027 gbinv371.seq 1481797904 gbinv372.seq 1448615417 gbinv373.seq 1497318179 gbinv374.seq 1482942614 gbinv375.seq 1491980118 gbinv376.seq 1474614092 gbinv377.seq 1493902745 gbinv378.seq 1278522756 gbinv379.seq 1489861947 gbinv38.seq 1482901794 gbinv380.seq 1456649541 gbinv381.seq 1434040169 gbinv382.seq 1484220657 gbinv383.seq 1480269708 gbinv384.seq 1477251799 gbinv385.seq 1488642106 gbinv386.seq 1464325796 gbinv387.seq 1338568836 gbinv388.seq 1490699998 gbinv389.seq 1444451059 gbinv39.seq 1419620460 gbinv390.seq 1476857168 gbinv391.seq 1483485112 gbinv392.seq 1491578026 gbinv393.seq 1491112499 gbinv394.seq 1479699050 gbinv395.seq 1480538411 gbinv396.seq 1472167723 gbinv397.seq 1486100359 gbinv398.seq 1481117526 gbinv399.seq 1492635630 gbinv4.seq 1482775396 gbinv40.seq 1492071757 gbinv400.seq 1499340126 gbinv401.seq 1497229795 gbinv402.seq 1479610005 gbinv403.seq 1483481633 gbinv404.seq 1474121526 gbinv405.seq 1490369993 gbinv406.seq 1405673874 gbinv407.seq 1458938909 gbinv408.seq 1349464140 gbinv409.seq 1485006015 gbinv41.seq 1495749208 gbinv410.seq 1476876176 gbinv411.seq 1473968850 gbinv412.seq 1323353583 gbinv413.seq 1491101509 gbinv414.seq 1484946141 gbinv415.seq 1470944718 gbinv416.seq 1472332405 gbinv417.seq 1481542660 gbinv418.seq 1492837082 gbinv419.seq 1401597428 gbinv42.seq 1479414174 gbinv420.seq 1466552136 gbinv421.seq 1431499002 gbinv422.seq 1485071634 gbinv423.seq 1494313977 gbinv424.seq 1493657490 gbinv425.seq 1480261094 gbinv426.seq 1483044191 gbinv427.seq 1445615250 gbinv428.seq 1497887640 gbinv429.seq 1308853046 gbinv43.seq 1471083260 gbinv430.seq 1497577490 gbinv431.seq 1499666284 gbinv432.seq 1460233365 gbinv433.seq 1496183446 gbinv434.seq 1498835879 gbinv435.seq 1473136630 gbinv436.seq 1479632452 gbinv437.seq 1208341643 gbinv438.seq 1475939186 gbinv439.seq 1396412444 gbinv44.seq 1492673455 gbinv440.seq 1461443834 gbinv441.seq 1499017367 gbinv442.seq 1480639218 gbinv443.seq 1489253877 gbinv444.seq 1499684845 gbinv445.seq 1498373944 gbinv446.seq 1477680980 gbinv447.seq 1469115028 gbinv448.seq 1486876777 gbinv449.seq 1323375076 gbinv45.seq 1494514455 gbinv450.seq 1419644627 gbinv451.seq 1498250624 gbinv452.seq 1487133459 gbinv453.seq 1393203164 gbinv454.seq 1408820705 gbinv455.seq 1497592776 gbinv456.seq 1478543593 gbinv457.seq 1392852049 gbinv458.seq 1499169382 gbinv459.seq 1370818982 gbinv46.seq 1466213638 gbinv460.seq 1469972842 gbinv461.seq 1457228715 gbinv462.seq 1497717270 gbinv463.seq 1494989185 gbinv464.seq 1278804881 gbinv465.seq 1380109384 gbinv466.seq 1386694032 gbinv467.seq 1420319566 gbinv468.seq 1318232257 gbinv469.seq 1466672268 gbinv47.seq 1488909769 gbinv470.seq 1481543850 gbinv471.seq 1481572717 gbinv472.seq 1479361265 gbinv473.seq 1401152941 gbinv474.seq 1496970120 gbinv475.seq 1478315328 gbinv476.seq 1429811506 gbinv477.seq 1376843258 gbinv478.seq 1465003259 gbinv479.seq 1433409157 gbinv48.seq 1497423367 gbinv480.seq 1346892194 gbinv481.seq 1454126994 gbinv482.seq 1487412138 gbinv483.seq 1483869014 gbinv484.seq 1473633031 gbinv485.seq 1482689248 gbinv486.seq 1452173892 gbinv487.seq 1499910356 gbinv488.seq 1464467532 gbinv489.seq 1478001451 gbinv49.seq 1415595604 gbinv490.seq 1487964141 gbinv491.seq 1486860991 gbinv492.seq 1321666770 gbinv493.seq 1474036684 gbinv494.seq 1483141065 gbinv495.seq 1472156670 gbinv496.seq 1218961667 gbinv497.seq 1462078348 gbinv498.seq 1488787648 gbinv499.seq 1495542399 gbinv5.seq 1482724771 gbinv50.seq 1471905916 gbinv500.seq 1391493380 gbinv501.seq 1496026145 gbinv502.seq 1498078804 gbinv503.seq 1389370141 gbinv504.seq 1495673760 gbinv505.seq 1477319963 gbinv506.seq 1079479462 gbinv507.seq 1109467889 gbinv508.seq 1498163797 gbinv509.seq 1444379504 gbinv51.seq 1394568218 gbinv510.seq 1447788761 gbinv511.seq 1375089916 gbinv512.seq 1426595891 gbinv513.seq 1493069100 gbinv514.seq 1481662028 gbinv515.seq 1495154891 gbinv516.seq 1496864645 gbinv517.seq 1491050563 gbinv518.seq 1364597049 gbinv519.seq 1425942927 gbinv52.seq 1388640271 gbinv520.seq 1491959054 gbinv521.seq 1407831816 gbinv522.seq 1385703901 gbinv523.seq 1495639181 gbinv524.seq 1417611840 gbinv525.seq 1497510098 gbinv526.seq 1473023838 gbinv527.seq 1493924480 gbinv528.seq 1481422601 gbinv529.seq 1280180275 gbinv53.seq 1476489682 gbinv530.seq 1481606161 gbinv531.seq 1491010677 gbinv532.seq 1457759003 gbinv533.seq 1496964572 gbinv534.seq 1471380270 gbinv535.seq 1260721997 gbinv536.seq 1342733543 gbinv537.seq 1439898744 gbinv538.seq 1488046142 gbinv539.seq 1313437692 gbinv54.seq 1423305614 gbinv540.seq 1488614206 gbinv541.seq 1452982888 gbinv542.seq 1496784656 gbinv543.seq 1490770554 gbinv544.seq 1465373730 gbinv545.seq 1393267431 gbinv546.seq 1485164207 gbinv547.seq 1472449267 gbinv548.seq 1404048967 gbinv549.seq 1326432934 gbinv55.seq 1436677322 gbinv550.seq 1431152112 gbinv551.seq 1281222010 gbinv552.seq 1358028214 gbinv553.seq 1472609949 gbinv554.seq 1483732011 gbinv555.seq 1420116512 gbinv556.seq 1463658433 gbinv557.seq 1469774909 gbinv558.seq 1226701605 gbinv559.seq 1146288120 gbinv56.seq 1306210890 gbinv560.seq 1433198249 gbinv561.seq 1450977854 gbinv562.seq 1461817474 gbinv563.seq 1467086830 gbinv564.seq 1490887879 gbinv565.seq 1477256069 gbinv566.seq 1467254407 gbinv567.seq 1498349895 gbinv568.seq 1270697515 gbinv569.seq 1386619309 gbinv57.seq 1341871502 gbinv570.seq 1484266751 gbinv571.seq 1497665631 gbinv572.seq 1472210219 gbinv573.seq 1486069414 gbinv574.seq 1446933300 gbinv575.seq 1499137697 gbinv576.seq 1474204754 gbinv577.seq 1498044562 gbinv578.seq 1454646065 gbinv579.seq 1370389051 gbinv58.seq 1487096126 gbinv580.seq 1467311739 gbinv581.seq 1480500723 gbinv582.seq 1481817241 gbinv583.seq 1476795535 gbinv584.seq 1498673712 gbinv585.seq 1499261517 gbinv586.seq 1384634809 gbinv587.seq 1497804718 gbinv588.seq 1496679675 gbinv589.seq 1472611741 gbinv59.seq 1459957287 gbinv590.seq 1482468906 gbinv591.seq 1423768165 gbinv592.seq 1442628124 gbinv593.seq 1408671977 gbinv594.seq 1459587614 gbinv595.seq 1495686792 gbinv596.seq 1496485527 gbinv597.seq 1499453043 gbinv598.seq 1434095883 gbinv599.seq 1484501116 gbinv6.seq 1499999135 gbinv60.seq 1145904134 gbinv600.seq 1490783280 gbinv601.seq 947444339 gbinv602.seq 1314904006 gbinv603.seq 1400237311 gbinv604.seq 1486294286 gbinv605.seq 1351185026 gbinv606.seq 1476207337 gbinv607.seq 1498782657 gbinv608.seq 1425379516 gbinv609.seq 1495461954 gbinv61.seq 1450802925 gbinv610.seq 1446182480 gbinv611.seq 1453100387 gbinv612.seq 1493134846 gbinv613.seq 1488621949 gbinv614.seq 1471191039 gbinv615.seq 1476559688 gbinv616.seq 1481154847 gbinv617.seq 1205574356 gbinv618.seq 1182998818 gbinv619.seq 1485482857 gbinv62.seq 1279279438 gbinv620.seq 1481084969 gbinv621.seq 1418592330 gbinv622.seq 1299281845 gbinv623.seq 1495538827 gbinv624.seq 1476144012 gbinv625.seq 1483226732 gbinv626.seq 1473677374 gbinv627.seq 1457019469 gbinv628.seq 1481834064 gbinv629.seq 1483889091 gbinv63.seq 1481025865 gbinv630.seq 1495965378 gbinv631.seq 1471490293 gbinv632.seq 1495774199 gbinv633.seq 1356033010 gbinv634.seq 1475067708 gbinv635.seq 1494163792 gbinv636.seq 1331802375 gbinv637.seq 1472985171 gbinv638.seq 1229926808 gbinv639.seq 1491530745 gbinv64.seq 1477737198 gbinv640.seq 1424791995 gbinv641.seq 1468769087 gbinv642.seq 1497913605 gbinv643.seq 1271418322 gbinv644.seq 1301564944 gbinv645.seq 1471879735 gbinv646.seq 1053708692 gbinv647.seq 1380265120 gbinv648.seq 1396131978 gbinv649.seq 1458661623 gbinv65.seq 1489555206 gbinv650.seq 1433410953 gbinv651.seq 1351353812 gbinv652.seq 1242394563 gbinv653.seq 1499324418 gbinv654.seq 1473661888 gbinv655.seq 1449356018 gbinv656.seq 1475967180 gbinv657.seq 1493682713 gbinv658.seq 1496001917 gbinv659.seq 1494727871 gbinv66.seq 1469126947 gbinv660.seq 1296705383 gbinv661.seq 1466230627 gbinv662.seq 1343924683 gbinv663.seq 1496203289 gbinv664.seq 1484700308 gbinv665.seq 1188686041 gbinv666.seq 1441258603 gbinv667.seq 1462772577 gbinv668.seq 1495266184 gbinv669.seq 1496809730 gbinv67.seq 1494695214 gbinv670.seq 1391522872 gbinv671.seq 1470077879 gbinv672.seq 1294029204 gbinv673.seq 1274422615 gbinv674.seq 1205408689 gbinv675.seq 1104142746 gbinv676.seq 1036632038 gbinv677.seq 1332903523 gbinv678.seq 1190138460 gbinv679.seq 1475473728 gbinv68.seq 1381167273 gbinv680.seq 1482941221 gbinv681.seq 1334265228 gbinv682.seq 1420389028 gbinv683.seq 1404385637 gbinv684.seq 1460306639 gbinv685.seq 1462227058 gbinv686.seq 1436988806 gbinv687.seq 1491802675 gbinv688.seq 1492108404 gbinv689.seq 1479399447 gbinv69.seq 1367921076 gbinv690.seq 1494199652 gbinv691.seq 1123984168 gbinv692.seq 874599051 gbinv693.seq 872525010 gbinv694.seq 810605264 gbinv695.seq 791733648 gbinv696.seq 789407447 gbinv697.seq 782472280 gbinv698.seq 1478877159 gbinv699.seq 1490828708 gbinv7.seq 1489183482 gbinv70.seq 1425054466 gbinv700.seq 1232428257 gbinv701.seq 1449091071 gbinv702.seq 1494179416 gbinv703.seq 1451306539 gbinv704.seq 1446725042 gbinv705.seq 1492012562 gbinv706.seq 1485251352 gbinv707.seq 1440797550 gbinv708.seq 1489644341 gbinv709.seq 1491679059 gbinv71.seq 1129926614 gbinv710.seq 1478985096 gbinv711.seq 1436917067 gbinv712.seq 1304573259 gbinv713.seq 1447912985 gbinv714.seq 1477159679 gbinv715.seq 1441002488 gbinv716.seq 1358342669 gbinv717.seq 1495926001 gbinv718.seq 1489540966 gbinv719.seq 1490447616 gbinv72.seq 1385541461 gbinv720.seq 1490668437 gbinv721.seq 1498773544 gbinv722.seq 1494280310 gbinv723.seq 1478659130 gbinv724.seq 1490369912 gbinv725.seq 1454124707 gbinv726.seq 1480065459 gbinv727.seq 1477473627 gbinv728.seq 1458431340 gbinv729.seq 1476783029 gbinv73.seq 1267258270 gbinv730.seq 1499431451 gbinv731.seq 1384116066 gbinv732.seq 1474301866 gbinv733.seq 1204760525 gbinv734.seq 1460137155 gbinv735.seq 1476820917 gbinv736.seq 1353805130 gbinv737.seq 1413692605 gbinv738.seq 1470780301 gbinv739.seq 1494372797 gbinv74.seq 1484656775 gbinv740.seq 1469691984 gbinv741.seq 1495706071 gbinv742.seq 1297579350 gbinv743.seq 1375758712 gbinv744.seq 1454532764 gbinv745.seq 1497622251 gbinv746.seq 1370789201 gbinv747.seq 1487438204 gbinv748.seq 1492927296 gbinv749.seq 1494156800 gbinv75.seq 1492982073 gbinv750.seq 1447577144 gbinv751.seq 1431751206 gbinv752.seq 1489605332 gbinv753.seq 1473901975 gbinv754.seq 1460312138 gbinv755.seq 1453756518 gbinv756.seq 1382808233 gbinv757.seq 1482348831 gbinv758.seq 1487170658 gbinv759.seq 1479762367 gbinv76.seq 1059460203 gbinv760.seq 1191529685 gbinv761.seq 1176457428 gbinv762.seq 1118724487 gbinv763.seq 1448943866 gbinv764.seq 1436999462 gbinv765.seq 1484689588 gbinv766.seq 1440414507 gbinv767.seq 1462302632 gbinv768.seq 1488222525 gbinv769.seq 1494270589 gbinv77.seq 1477654788 gbinv770.seq 1489253061 gbinv771.seq 1461105919 gbinv772.seq 1478159867 gbinv773.seq 1460415262 gbinv774.seq 1414082589 gbinv775.seq 1496092284 gbinv776.seq 1489437069 gbinv777.seq 1434779449 gbinv778.seq 1490169295 gbinv779.seq 1488497214 gbinv78.seq 1422857454 gbinv780.seq 1443657577 gbinv781.seq 1497278359 gbinv782.seq 1482389324 gbinv783.seq 1475136219 gbinv784.seq 1372239564 gbinv785.seq 1391999432 gbinv786.seq 1453801728 gbinv787.seq 1497276601 gbinv788.seq 1488917878 gbinv789.seq 1492624232 gbinv79.seq 1343376981 gbinv790.seq 1431137590 gbinv791.seq 1470649030 gbinv792.seq 1495674056 gbinv793.seq 1484392796 gbinv794.seq 1370380504 gbinv795.seq 1271919212 gbinv796.seq 1302247251 gbinv797.seq 1373305750 gbinv798.seq 1375693754 gbinv799.seq 1498018820 gbinv8.seq 1473485502 gbinv80.seq 1464671547 gbinv800.seq 1459541391 gbinv801.seq 1489406014 gbinv802.seq 1490586273 gbinv803.seq 1493837031 gbinv804.seq 1400217161 gbinv805.seq 1413210457 gbinv806.seq 1490609103 gbinv807.seq 1497732159 gbinv808.seq 1219453804 gbinv809.seq 1499999436 gbinv81.seq 1264302105 gbinv810.seq 1485822793 gbinv811.seq 1418685752 gbinv812.seq 1482216219 gbinv813.seq 1417478148 gbinv814.seq 1494543420 gbinv815.seq 1417238594 gbinv816.seq 1366815666 gbinv817.seq 1494169441 gbinv818.seq 999981017 gbinv819.seq 1499998600 gbinv82.seq 1368088650 gbinv820.seq 1408578588 gbinv821.seq 1498542038 gbinv822.seq 1397635787 gbinv823.seq 1081620427 gbinv824.seq 1431826102 gbinv825.seq 1401372891 gbinv826.seq 1448756584 gbinv827.seq 1488109642 gbinv828.seq 1489078785 gbinv829.seq 1499999608 gbinv83.seq 1460733085 gbinv830.seq 1474715637 gbinv831.seq 1472124950 gbinv832.seq 1423732997 gbinv833.seq 1431479439 gbinv834.seq 1414088464 gbinv835.seq 1427352569 gbinv836.seq 1486212943 gbinv837.seq 1439790726 gbinv838.seq 1345947195 gbinv839.seq 1499997796 gbinv84.seq 1409851510 gbinv840.seq 1497428187 gbinv841.seq 1491627673 gbinv842.seq 1407776038 gbinv843.seq 1486091565 gbinv844.seq 1447417238 gbinv845.seq 1424173513 gbinv846.seq 1471376370 gbinv847.seq 1483914022 gbinv848.seq 1476930495 gbinv849.seq 1500000263 gbinv85.seq 1495375621 gbinv850.seq 1483997276 gbinv851.seq 1477023313 gbinv852.seq 1484489275 gbinv853.seq 1364991275 gbinv854.seq 1327457514 gbinv855.seq 1445905313 gbinv856.seq 1480024391 gbinv857.seq 1492434371 gbinv858.seq 1483244834 gbinv859.seq 1499981061 gbinv86.seq 1334750741 gbinv860.seq 1340130480 gbinv861.seq 1428711159 gbinv862.seq 1292257015 gbinv863.seq 1453904599 gbinv864.seq 1490727749 gbinv865.seq 1479824478 gbinv866.seq 1446168967 gbinv867.seq 1483787645 gbinv868.seq 1234619086 gbinv869.seq 1499997046 gbinv87.seq 1489639731 gbinv870.seq 1478350948 gbinv871.seq 1472613427 gbinv872.seq 1463136815 gbinv873.seq 1491310938 gbinv874.seq 1437190175 gbinv875.seq 1490433581 gbinv876.seq 1491351228 gbinv877.seq 1459189685 gbinv878.seq 1438910128 gbinv879.seq 1499998149 gbinv88.seq 1165149605 gbinv880.seq 1443358202 gbinv881.seq 1231751195 gbinv882.seq 1465887213 gbinv883.seq 1427380300 gbinv884.seq 1498007467 gbinv885.seq 1492780193 gbinv886.seq 1310752098 gbinv887.seq 1491528231 gbinv888.seq 1372426883 gbinv889.seq 1499998677 gbinv89.seq 1429260753 gbinv890.seq 1491982622 gbinv891.seq 1499828325 gbinv892.seq 1489546246 gbinv893.seq 1450002158 gbinv894.seq 1432656091 gbinv895.seq 1492803541 gbinv896.seq 1483685180 gbinv897.seq 1494338837 gbinv898.seq 1489389384 gbinv899.seq 1428223230 gbinv9.seq 1499999035 gbinv90.seq 1486778178 gbinv900.seq 1434934426 gbinv901.seq 1455774368 gbinv902.seq 1486106378 gbinv903.seq 1499849036 gbinv904.seq 1473633903 gbinv905.seq 1482973725 gbinv906.seq 1484221924 gbinv907.seq 1488305213 gbinv908.seq 1341678524 gbinv909.seq 1498483904 gbinv91.seq 1442932031 gbinv910.seq 1495746307 gbinv911.seq 1498425116 gbinv912.seq 1439194314 gbinv913.seq 1478548450 gbinv914.seq 1494920288 gbinv915.seq 1460584282 gbinv916.seq 1487364619 gbinv917.seq 1426848422 gbinv918.seq 1493673312 gbinv919.seq 1476126635 gbinv92.seq 1482903493 gbinv920.seq 1487205334 gbinv921.seq 1469647013 gbinv922.seq 1486282059 gbinv923.seq 1361591905 gbinv924.seq 1499953075 gbinv925.seq 1489844835 gbinv926.seq 1482428730 gbinv927.seq 1486971917 gbinv928.seq 1420401547 gbinv929.seq 1495434034 gbinv93.seq 1388400194 gbinv930.seq 1475131785 gbinv931.seq 1476195285 gbinv932.seq 1480806959 gbinv933.seq 1484726887 gbinv934.seq 1479052463 gbinv935.seq 1493623105 gbinv936.seq 1483436320 gbinv937.seq 1317793217 gbinv938.seq 1497561482 gbinv939.seq 1493053809 gbinv94.seq 1492806237 gbinv940.seq 1483017598 gbinv941.seq 1493804427 gbinv942.seq 1491801040 gbinv943.seq 1489411242 gbinv944.seq 1470597424 gbinv945.seq 1420931462 gbinv946.seq 1497146468 gbinv947.seq 1492185599 gbinv948.seq 1499197975 gbinv949.seq 1497294547 gbinv95.seq 1423445069 gbinv950.seq 1496814435 gbinv951.seq 1452718550 gbinv952.seq 1464730622 gbinv953.seq 1487859516 gbinv954.seq 1435686093 gbinv955.seq 1480835874 gbinv956.seq 1493713318 gbinv957.seq 1476752502 gbinv958.seq 1475411397 gbinv959.seq 1499787801 gbinv96.seq 1494755768 gbinv960.seq 1498456550 gbinv961.seq 1487653876 gbinv962.seq 1485417008 gbinv963.seq 1481040939 gbinv964.seq 1499804629 gbinv965.seq 1414900160 gbinv966.seq 1498360694 gbinv967.seq 1495453680 gbinv968.seq 1353663639 gbinv969.seq 1494757802 gbinv97.seq 1438016527 gbinv970.seq 1482241175 gbinv971.seq 1492486762 gbinv972.seq 1490071113 gbinv973.seq 1486148721 gbinv974.seq 1498609189 gbinv975.seq 1490859889 gbinv976.seq 1476040720 gbinv977.seq 1480492610 gbinv978.seq 1486313249 gbinv979.seq 1482599631 gbinv98.seq 1429808343 gbinv980.seq 1430781223 gbinv981.seq 1480274532 gbinv982.seq 1476654539 gbinv983.seq 1493523749 gbinv984.seq 1476569538 gbinv985.seq 1430729968 gbinv986.seq 1482674920 gbinv987.seq 1421263767 gbinv988.seq 1339463809 gbinv989.seq 1495081450 gbinv99.seq 1363357074 gbinv990.seq 1463417934 gbinv991.seq 1491845237 gbinv992.seq 1419809269 gbinv993.seq 1482163240 gbinv994.seq 1474610732 gbinv995.seq 1474472988 gbinv996.seq 1452885321 gbinv997.seq 1269322721 gbinv998.seq 1462273049 gbinv999.seq 1299915404 gbmam1.seq 1433374449 gbmam10.seq 1462961854 gbmam100.seq 1493460490 gbmam101.seq 1242695251 gbmam102.seq 1452781978 gbmam103.seq 1454575888 gbmam104.seq 1388384055 gbmam105.seq 1442404367 gbmam106.seq 1322250073 gbmam107.seq 1485659023 gbmam108.seq 1334022069 gbmam109.seq 1452368889 gbmam11.seq 1472621969 gbmam110.seq 1206593294 gbmam111.seq 1421940574 gbmam112.seq 1476369631 gbmam113.seq 1432986514 gbmam114.seq 1430519953 gbmam115.seq 1354379872 gbmam116.seq 1493840711 gbmam117.seq 1409540017 gbmam118.seq 1486397049 gbmam119.seq 1440036034 gbmam12.seq 1487622173 gbmam120.seq 1459044453 gbmam121.seq 1471819995 gbmam122.seq 1477118637 gbmam123.seq 1288636649 gbmam124.seq 1323695653 gbmam125.seq 1416834040 gbmam126.seq 1341709714 gbmam127.seq 1437951730 gbmam128.seq 1324905556 gbmam129.seq 1497426774 gbmam13.seq 1340636193 gbmam130.seq 1152187175 gbmam131.seq 1296520546 gbmam132.seq 1411514202 gbmam133.seq 1385494744 gbmam134.seq 1480062815 gbmam135.seq 1357593611 gbmam136.seq 1430130592 gbmam137.seq 1471191394 gbmam138.seq 1405280611 gbmam139.seq 1487057346 gbmam14.seq 1331524451 gbmam140.seq 1379376566 gbmam141.seq 1392387812 gbmam142.seq 1498621108 gbmam143.seq 1424747897 gbmam144.seq 1443349897 gbmam145.seq 1397223064 gbmam146.seq 1292658067 gbmam147.seq 1349694421 gbmam148.seq 1461018701 gbmam149.seq 1433300115 gbmam15.seq 1261683771 gbmam150.seq 1371229989 gbmam151.seq 1404307984 gbmam152.seq 1435643956 gbmam153.seq 1433756151 gbmam154.seq 1421228681 gbmam155.seq 1300863918 gbmam156.seq 1414392316 gbmam157.seq 1346105575 gbmam158.seq 1468473611 gbmam159.seq 1485894617 gbmam16.seq 1435497483 gbmam160.seq 1485785097 gbmam161.seq 1499422142 gbmam162.seq 1450069987 gbmam163.seq 1383921642 gbmam164.seq 1417782624 gbmam165.seq 1421042576 gbmam166.seq 1460770200 gbmam167.seq 1271824090 gbmam168.seq 1357027343 gbmam169.seq 1345861608 gbmam17.seq 1343004536 gbmam170.seq 1414736039 gbmam171.seq 1446203177 gbmam172.seq 1489056597 gbmam173.seq 1398350299 gbmam174.seq 1444998357 gbmam175.seq 1464215354 gbmam176.seq 1387458768 gbmam177.seq 1485417231 gbmam178.seq 1467108453 gbmam179.seq 1404073848 gbmam18.seq 1403385272 gbmam180.seq 1456440946 gbmam181.seq 1468921836 gbmam182.seq 1394926630 gbmam183.seq 1422503741 gbmam184.seq 1283559404 gbmam185.seq 1445065618 gbmam186.seq 1498885294 gbmam187.seq 1424349341 gbmam188.seq 1401192174 gbmam189.seq 1315922420 gbmam19.seq 1269288650 gbmam190.seq 1482030681 gbmam191.seq 1471833386 gbmam192.seq 1358976275 gbmam193.seq 1454941336 gbmam194.seq 1415823552 gbmam195.seq 1473188207 gbmam196.seq 1444938066 gbmam197.seq 1437567361 gbmam198.seq 1414328635 gbmam199.seq 1490951841 gbmam2.seq 1367843978 gbmam20.seq 1454489615 gbmam200.seq 1466725975 gbmam201.seq 1435611686 gbmam202.seq 1494922836 gbmam203.seq 1370104866 gbmam204.seq 1465267923 gbmam205.seq 1380536175 gbmam206.seq 1495328000 gbmam207.seq 1383550077 gbmam208.seq 1402521234 gbmam209.seq 1468252034 gbmam21.seq 1443424312 gbmam210.seq 1424949178 gbmam211.seq 1419291321 gbmam212.seq 1454200771 gbmam213.seq 1456913954 gbmam214.seq 1365208588 gbmam215.seq 1444001834 gbmam216.seq 1348991777 gbmam217.seq 1474480534 gbmam218.seq 1463385072 gbmam219.seq 1393139762 gbmam22.seq 1481852756 gbmam220.seq 1424309965 gbmam221.seq 1459023783 gbmam222.seq 1462955963 gbmam223.seq 1449590753 gbmam224.seq 1406236219 gbmam225.seq 1471510420 gbmam226.seq 1411560055 gbmam227.seq 1431014093 gbmam228.seq 1492211725 gbmam229.seq 1466817553 gbmam23.seq 1394392239 gbmam230.seq 1499643885 gbmam231.seq 1423467838 gbmam232.seq 1483573392 gbmam233.seq 1471057886 gbmam234.seq 533184849 gbmam235.seq 1488080656 gbmam24.seq 1483917563 gbmam25.seq 1434132825 gbmam26.seq 1485351268 gbmam27.seq 1453128998 gbmam28.seq 1494333882 gbmam29.seq 1141248961 gbmam3.seq 1464519465 gbmam30.seq 1441977794 gbmam31.seq 1446827567 gbmam32.seq 1455111173 gbmam33.seq 1385308836 gbmam34.seq 1424749144 gbmam35.seq 1410339361 gbmam36.seq 1378454484 gbmam37.seq 1434286183 gbmam38.seq 1499998760 gbmam39.seq 1342505130 gbmam4.seq 1487420596 gbmam40.seq 1480436027 gbmam41.seq 1412945390 gbmam42.seq 907465328 gbmam43.seq 839494897 gbmam44.seq 1363269325 gbmam45.seq 1343119710 gbmam46.seq 1465682461 gbmam47.seq 1327495298 gbmam48.seq 1455155074 gbmam49.seq 1484831122 gbmam5.seq 1403782872 gbmam50.seq 1389175376 gbmam51.seq 1460772173 gbmam52.seq 1499643620 gbmam53.seq 1494407093 gbmam54.seq 1402987084 gbmam55.seq 1457822726 gbmam56.seq 1378379964 gbmam57.seq 1383632423 gbmam58.seq 1405357741 gbmam59.seq 1429536704 gbmam6.seq 1391014983 gbmam60.seq 1494228754 gbmam61.seq 1381077122 gbmam62.seq 1416530939 gbmam63.seq 1476987068 gbmam64.seq 1422332307 gbmam65.seq 1460812724 gbmam66.seq 1291806306 gbmam67.seq 1494037381 gbmam68.seq 1410912360 gbmam69.seq 1485960787 gbmam7.seq 1391555991 gbmam70.seq 1455556343 gbmam71.seq 1499419417 gbmam72.seq 1471507295 gbmam73.seq 1416080754 gbmam74.seq 1487484232 gbmam75.seq 1418284918 gbmam76.seq 1491622135 gbmam77.seq 1303199123 gbmam78.seq 1441482016 gbmam79.seq 1435168677 gbmam8.seq 1345159341 gbmam80.seq 1472528753 gbmam81.seq 1427875805 gbmam82.seq 1399062857 gbmam83.seq 1414660891 gbmam84.seq 1415873621 gbmam85.seq 1458863948 gbmam86.seq 1342253658 gbmam87.seq 1498868645 gbmam88.seq 1463009820 gbmam89.seq 1460040942 gbmam9.seq 1456467538 gbmam90.seq 1379189978 gbmam91.seq 1447676383 gbmam92.seq 1296500576 gbmam93.seq 1354636780 gbmam94.seq 1352755686 gbmam95.seq 1388614346 gbmam96.seq 1274912466 gbmam97.seq 1431579826 gbmam98.seq 1389201546 gbmam99.seq 8268642 gbnew.txt 1499999572 gbpat1.seq 1499999753 gbpat10.seq 1499999175 gbpat11.seq 1498990335 gbpat12.seq 1499999171 gbpat13.seq 1499999511 gbpat14.seq 1499999689 gbpat15.seq 1499999753 gbpat16.seq 1498719175 gbpat17.seq 1499997555 gbpat18.seq 1499998583 gbpat19.seq 1499999060 gbpat2.seq 1500000039 gbpat20.seq 1499999356 gbpat21.seq 1499999642 gbpat22.seq 1499999626 gbpat23.seq 1499996830 gbpat24.seq 1500000250 gbpat25.seq 1500000081 gbpat26.seq 1499999286 gbpat27.seq 1499999747 gbpat28.seq 1500000070 gbpat29.seq 1499999317 gbpat3.seq 1499998881 gbpat30.seq 1499887962 gbpat31.seq 1499944562 gbpat32.seq 1499999914 gbpat33.seq 1499999218 gbpat34.seq 1499997999 gbpat35.seq 1499999304 gbpat36.seq 1499999891 gbpat37.seq 1500000034 gbpat38.seq 1499999514 gbpat39.seq 1499999851 gbpat4.seq 1499284742 gbpat40.seq 1499963549 gbpat41.seq 1499996188 gbpat42.seq 1499969410 gbpat43.seq 1500000246 gbpat44.seq 1499999556 gbpat45.seq 1499998618 gbpat46.seq 1499995820 gbpat47.seq 1499998069 gbpat48.seq 1499997162 gbpat49.seq 1499999567 gbpat5.seq 1499999736 gbpat50.seq 1500000136 gbpat51.seq 1500000230 gbpat52.seq 1499998975 gbpat53.seq 1499999653 gbpat54.seq 1499999897 gbpat55.seq 1499995649 gbpat56.seq 1499998835 gbpat57.seq 1499999986 gbpat58.seq 1499697457 gbpat59.seq 1499998839 gbpat6.seq 1499064907 gbpat60.seq 1499999869 gbpat61.seq 1499999778 gbpat62.seq 1499594959 gbpat63.seq 1499764801 gbpat64.seq 1497542611 gbpat65.seq 1499999114 gbpat66.seq 1499998067 gbpat67.seq 1499999708 gbpat68.seq 1499999945 gbpat69.seq 1499999903 gbpat7.seq 1499999450 gbpat70.seq 1494710690 gbpat71.seq 1498399148 gbpat72.seq 1500000241 gbpat73.seq 1499999833 gbpat74.seq 1499814848 gbpat75.seq 1499997227 gbpat76.seq 1499998866 gbpat77.seq 1499999392 gbpat78.seq 1499999127 gbpat79.seq 1500000097 gbpat8.seq 1499995267 gbpat80.seq 1499998215 gbpat81.seq 1499998361 gbpat82.seq 1499648196 gbpat83.seq 1498424098 gbpat84.seq 1499998319 gbpat85.seq 1204681420 gbpat86.seq 211874505 gbpat87.seq (Patched to pat86) 1500000184 gbpat9.seq 1499991521 gbphg1.seq 1499956797 gbphg2.seq 1454305416 gbphg3.seq 1499875340 gbpln1.seq 1490892671 gbpln10.seq 1465826136 gbpln100.seq 1268463887 gbpln1000.se 1132179668 gbpln1001.se 1003746389 gbpln1002.se 1166255872 gbpln1003.se 1134982387 gbpln1004.se 1251118797 gbpln1005.se 1187012279 gbpln1006.se 1466143112 gbpln1007.se 818127642 gbpln1008.se 914902975 gbpln1009.se 1498450084 gbpln101.seq 770036001 gbpln1010.se 1488055478 gbpln1011.se 1270459984 gbpln1012.se 1126985818 gbpln1013.se 1004641871 gbpln1014.se 1313605806 gbpln1015.se 1144217468 gbpln1016.se 1240145046 gbpln1017.se 1100905977 gbpln1018.se 1313991011 gbpln1019.se 1494184912 gbpln102.seq 811035702 gbpln1020.se 916495762 gbpln1021.se 771255491 gbpln1022.se 1490492663 gbpln1023.se 1261054579 gbpln1024.se 1129861765 gbpln1025.se 992831954 gbpln1026.se 1173682306 gbpln1027.se 1088755672 gbpln1028.se 1213616859 gbpln1029.se 1476152223 gbpln103.seq 1090177929 gbpln1030.se 1440802396 gbpln1031.se 805704483 gbpln1032.se 893997655 gbpln1033.se 773531574 gbpln1034.se 1497692205 gbpln1035.se 1259358154 gbpln1036.se 1126517541 gbpln1037.se 992561060 gbpln1038.se 1328017903 gbpln1039.se 1431083477 gbpln104.seq 1143386902 gbpln1040.se 1236615764 gbpln1041.se 1111123511 gbpln1042.se 1324797781 gbpln1043.se 800245922 gbpln1044.se 918564460 gbpln1045.se 786644944 gbpln1046.se 1497990682 gbpln1047.se 1285230611 gbpln1048.se 1172909008 gbpln1049.se 1443315566 gbpln105.seq 1016508476 gbpln1050.se 1327657669 gbpln1051.se 1138680789 gbpln1052.se 1260267465 gbpln1053.se 1192859190 gbpln1054.se 1309584700 gbpln1055.se 796886876 gbpln1056.se 910426915 gbpln1057.se 774569412 gbpln1058.se 1473080932 gbpln1059.se 1458146029 gbpln106.seq 1270591534 gbpln1060.se 1132514055 gbpln1061.se 1001350372 gbpln1062.se 1274673529 gbpln1063.se 1032373817 gbpln1064.se 1112706725 gbpln1065.se 1085802714 gbpln1066.se 1227312820 gbpln1067.se 756767585 gbpln1068.se 879243196 gbpln1069.se 1450295359 gbpln107.seq 751772246 gbpln1070.se 1449493840 gbpln1071.se 1254581814 gbpln1072.se 1116772133 gbpln1073.se 1016577888 gbpln1074.se 1222844159 gbpln1075.se 1058214618 gbpln1076.se 1152262602 gbpln1077.se 1111063358 gbpln1078.se 1264195325 gbpln1079.se 1437751080 gbpln108.seq 764465714 gbpln1080.se 870362571 gbpln1081.se 762373240 gbpln1082.se 1464579737 gbpln1083.se 1249614538 gbpln1084.se 1112890452 gbpln1085.se 1022159003 gbpln1086.se 1295556833 gbpln1087.se 1112214405 gbpln1088.se 1217677846 gbpln1089.se 1429906345 gbpln109.seq 1058563593 gbpln1090.se 1322791545 gbpln1091.se 804216882 gbpln1092.se 902025411 gbpln1093.se 769462916 gbpln1094.se 820422328 gbpln1095.se 1265702567 gbpln1096.se 1156484554 gbpln1097.se 1141649087 gbpln1098.se 1023205205 gbpln1099.se 1408071661 gbpln11.seq 1432395801 gbpln110.seq 1306048482 gbpln1100.se 1148129266 gbpln1101.se 1211578714 gbpln1102.se 1217512890 gbpln1103.se 740379596 gbpln1104.se 813535530 gbpln1105.se 922722290 gbpln1106.se 783563128 gbpln1107.se 797036967 gbpln1108.se 1335594048 gbpln1109.se 1461915613 gbpln111.seq 1281542446 gbpln1110.se 1208484131 gbpln1111.se 997970554 gbpln1112.se 1302806311 gbpln1113.se 1165192066 gbpln1114.se 1179825561 gbpln1115.se 1127573410 gbpln1116.se 720781352 gbpln1117.se 816693453 gbpln1118.se 926433452 gbpln1119.se 1499418405 gbpln112.seq 780626145 gbpln1120.se 1485204478 gbpln1121.se 1280595050 gbpln1122.se 1092344793 gbpln1123.se 1019066776 gbpln1124.se 1345652866 gbpln1125.se 1157629431 gbpln1126.se 1270494458 gbpln1127.se 1233752776 gbpln1128.se 1438000597 gbpln1129.se 799028761 gbpln113.seq 815709146 gbpln1130.se 922047630 gbpln1131.se 782760377 gbpln1132.se 810883668 gbpln1133.se 1308527286 gbpln1134.se 1278252058 gbpln1135.se 1206632557 gbpln1136.se 1015494475 gbpln1137.se 1287154439 gbpln1138.se 1187904422 gbpln1139.se 818536598 gbpln114.seq 1185150809 gbpln1140.se 1206817236 gbpln1141.se 755882541 gbpln1142.se 812101990 gbpln1143.se 909990150 gbpln1144.se 790419227 gbpln1145.se 797020556 gbpln1146.se 1314793815 gbpln1147.se 1277635699 gbpln1148.se 1235360604 gbpln1149.se 744339771 gbpln115.seq 1472951907 gbpln1150.se 1431422615 gbpln1151.se 1461600866 gbpln1152.se 1374795344 gbpln1153.se 1461785827 gbpln1154.se 1442529858 gbpln1155.se 1487633903 gbpln1156.se 915213097 gbpln1157.se 759028963 gbpln1158.se 898515700 gbpln1159.se 840483636 gbpln116.seq 632798068 gbpln1160.se 1008257789 gbpln1161.se 1024893843 gbpln1162.se 849343523 gbpln1163.se 961475222 gbpln1164.se 1105698153 gbpln1165.se 806976196 gbpln1166.se 970150208 gbpln1167.se 872155148 gbpln1168.se 676154306 gbpln1169.se 1482268558 gbpln117.seq 905516658 gbpln1170.se 922918715 gbpln1171.se 742368797 gbpln1172.se 788401310 gbpln1173.se 929538815 gbpln1174.se 641895881 gbpln1175.se 961976330 gbpln1176.se 973033563 gbpln1177.se 834845431 gbpln1178.se 1096228946 gbpln1179.se 1445216054 gbpln118.seq 1065747702 gbpln1180.se 978382754 gbpln1181.se 970377846 gbpln1182.se 932157798 gbpln1183.se 878151181 gbpln1184.se 874085482 gbpln1185.se 829265283 gbpln1186.se 863296713 gbpln1187.se 823515697 gbpln1188.se 815413879 gbpln1189.se 1499019904 gbpln119.seq 1384284612 gbpln1190.se 1351462559 gbpln1191.se 1230738647 gbpln1192.se 541733672 gbpln1193.se 2012725365 gbpln1194.se 2313576157 gbpln1195.se 2199353951 gbpln1196.se 2096617949 gbpln1197.se 2106642321 gbpln1198.se 1745413840 gbpln1199.se 1475361913 gbpln12.seq 1471007441 gbpln120.seq 1943630374 gbpln1200.se 1096169937 gbpln1201.se 836152674 gbpln1202.se 790234195 gbpln1203.se 768134127 gbpln1204.se 1464177022 gbpln1205.se 1454383719 gbpln1206.se 839765735 gbpln1207.se 794136796 gbpln1208.se 777214952 gbpln1209.se 1497460973 gbpln121.seq 1459963688 gbpln1210.se 1453910480 gbpln1211.se 831555005 gbpln1212.se 787385082 gbpln1213.se 774061569 gbpln1214.se 1444041490 gbpln1215.se 1462025011 gbpln1216.se 837904863 gbpln1217.se 793009109 gbpln1218.se 770582516 gbpln1219.se 1497729906 gbpln122.seq 1458992601 gbpln1220.se 1472670482 gbpln1221.se 837974599 gbpln1222.se 802983166 gbpln1223.se 776399715 gbpln1224.se 1452076154 gbpln1225.se 1467682459 gbpln1226.se 841987687 gbpln1227.se 800255274 gbpln1228.se 776782163 gbpln1229.se 1489362717 gbpln123.seq 765490378 gbpln1230.se 737409431 gbpln1231.se 1467554405 gbpln1232.se 838067529 gbpln1233.se 794050155 gbpln1234.se 769006557 gbpln1235.se 1456537015 gbpln1236.se 1456423619 gbpln1237.se 831709070 gbpln1238.se 788018842 gbpln1239.se 1499092145 gbpln124.seq 776335169 gbpln1240.se 1447227790 gbpln1241.se 1462058950 gbpln1242.se 831948388 gbpln1243.se 792155198 gbpln1244.se 764395262 gbpln1245.se 1469026353 gbpln1246.se 1457035185 gbpln1247.se 832913531 gbpln1248.se 783381753 gbpln1249.se 1473551999 gbpln125.seq 777226068 gbpln1250.se 1449010173 gbpln1251.se 1460033797 gbpln1252.se 856583956 gbpln1253.se 800941652 gbpln1254.se 764839742 gbpln1255.se 1463437687 gbpln1256.se 1457211428 gbpln1257.se 838548263 gbpln1258.se 802434969 gbpln1259.se 1497683966 gbpln126.seq 775426580 gbpln1260.se 1468251988 gbpln1261.se 1456996280 gbpln1262.se 836584181 gbpln1263.se 794556424 gbpln1264.se 763379903 gbpln1265.se 1472540376 gbpln1266.se 1467456049 gbpln1267.se 841588738 gbpln1268.se 793586134 gbpln1269.se 1339792010 gbpln127.seq 774193867 gbpln1270.se 1483592341 gbpln1271.se 1464730711 gbpln1272.se 832767208 gbpln1273.se 787519848 gbpln1274.se 773580779 gbpln1275.se 1453968538 gbpln1276.se 1458876982 gbpln1277.se 836647346 gbpln1278.se 804025439 gbpln1279.se 946931884 gbpln128.seq 780287538 gbpln1280.se 1456910352 gbpln1281.se 1461116472 gbpln1282.se 847868246 gbpln1283.se 799503372 gbpln1284.se 769858206 gbpln1285.se 1451384311 gbpln1286.se 1448178189 gbpln1287.se 841182041 gbpln1288.se 790643458 gbpln1289.se 1121159029 gbpln129.seq 771991396 gbpln1290.se 1449905951 gbpln1291.se 799948094 gbpln1292.se 836052023 gbpln1293.se 791807903 gbpln1294.se 771195581 gbpln1295.se 1452626437 gbpln1296.se 1452862185 gbpln1297.se 666670554 gbpln1298.se 841954477 gbpln1299.se 1383978349 gbpln13.seq 1164001315 gbpln130.seq 801058908 gbpln1300.se 777293273 gbpln1301.se 1485779606 gbpln1302.se 1452913123 gbpln1303.se 836617455 gbpln1304.se 790837080 gbpln1305.se 777459211 gbpln1306.se 1453527110 gbpln1307.se 1454781570 gbpln1308.se 839842771 gbpln1309.se 1483600477 gbpln131.seq 793797446 gbpln1310.se 776363695 gbpln1311.se 1456772382 gbpln1312.se 1466569984 gbpln1313.se 845148876 gbpln1314.se 804833075 gbpln1315.se 778470840 gbpln1316.se 1481006671 gbpln1317.se 1474068833 gbpln1318.se 794180240 gbpln1319.se 1314173387 gbpln132.seq 774312133 gbpln1320.se 1457303715 gbpln1321.se 835115958 gbpln1322.se 1457626965 gbpln1323.se 836718376 gbpln1324.se 801816184 gbpln1325.se 780710757 gbpln1326.se 1487855626 gbpln1327.se 1468374098 gbpln1328.se 835020955 gbpln1329.se 946518369 gbpln133.seq 794498288 gbpln1330.se 775035874 gbpln1331.se 1474921682 gbpln1332.se 1459702205 gbpln1333.se 836763144 gbpln1334.se 794319485 gbpln1335.se 771563218 gbpln1336.se 1442336042 gbpln1337.se 1461924553 gbpln1338.se 835744193 gbpln1339.se 1120694900 gbpln134.seq 793808494 gbpln1340.se 775366859 gbpln1341.se 1452650570 gbpln1342.se 1461461120 gbpln1343.se 839340148 gbpln1344.se 793588555 gbpln1345.se 778845059 gbpln1346.se 1471514124 gbpln1347.se 1460672453 gbpln1348.se 847689175 gbpln1349.se 1163541839 gbpln135.seq 797030463 gbpln1350.se 776617524 gbpln1351.se 1450233858 gbpln1352.se 1469651463 gbpln1353.se 834034797 gbpln1354.se 795540701 gbpln1355.se 776376885 gbpln1356.se 1448905128 gbpln1357.se 1457656304 gbpln1358.se 833009352 gbpln1359.se 1476385247 gbpln136.seq 797524540 gbpln1360.se 773297930 gbpln1361.se 1451244889 gbpln1362.se 1454193216 gbpln1363.se 830169429 gbpln1364.se 793310457 gbpln1365.se 773560290 gbpln1366.se 1446231891 gbpln1367.se 1450937303 gbpln1368.se 835938341 gbpln1369.se 1478729959 gbpln137.seq 795056321 gbpln1370.se 770765157 gbpln1371.se 1475561524 gbpln1372.se 1466579245 gbpln1373.se 829099164 gbpln1374.se 790989379 gbpln1375.se 773398673 gbpln1376.se 1462046272 gbpln1377.se 1449910042 gbpln1378.se 837413052 gbpln1379.se 1485502564 gbpln138.seq 790648527 gbpln1380.se 772176401 gbpln1381.se 1460620041 gbpln1382.se 1455765886 gbpln1383.se 833059054 gbpln1384.se 794545184 gbpln1385.se 774083177 gbpln1386.se 1448946753 gbpln1387.se 1458559584 gbpln1388.se 835451342 gbpln1389.se 1474379245 gbpln139.seq 794577233 gbpln1390.se 775251446 gbpln1391.se 1454531761 gbpln1392.se 1463618989 gbpln1393.se 836809812 gbpln1394.se 806584862 gbpln1395.se 776084155 gbpln1396.se 1485075661 gbpln1397.se 1448852265 gbpln1398.se 836125457 gbpln1399.se 1174886908 gbpln14.seq 1488776344 gbpln140.seq 794049612 gbpln1400.se 769729355 gbpln1401.se 1469601615 gbpln1402.se 1458361301 gbpln1403.se 840008504 gbpln1404.se 794029694 gbpln1405.se 769623341 gbpln1406.se 1477482614 gbpln1407.se 1456549528 gbpln1408.se 836931236 gbpln1409.se 1421926221 gbpln141.seq 792455888 gbpln1410.se 768695354 gbpln1411.se 1450909194 gbpln1412.se 1454926637 gbpln1413.se 835570197 gbpln1414.se 798619346 gbpln1415.se 776375847 gbpln1416.se 1468212148 gbpln1417.se 1463519623 gbpln1418.se 832456199 gbpln1419.se 1469834401 gbpln142.seq 793920035 gbpln1420.se 773324985 gbpln1421.se 1443647684 gbpln1422.se 1458966967 gbpln1423.se 834886228 gbpln1424.se 792465315 gbpln1425.se 766375549 gbpln1426.se 1449349195 gbpln1427.se 1457671779 gbpln1428.se 836173230 gbpln1429.se 1462261931 gbpln143.seq 792990723 gbpln1430.se 774691916 gbpln1431.se 1452432506 gbpln1432.se 797342703 gbpln1433.se 1496638015 gbpln1434.se 804070482 gbpln1435.se 777569920 gbpln1436.se 1461158646 gbpln1437.se 1466754128 gbpln1438.se 830451601 gbpln1439.se 1495543690 gbpln144.seq 798616435 gbpln1440.se 774880678 gbpln1441.se 1455218535 gbpln1442.se 1460523331 gbpln1443.se 837230145 gbpln1444.se 796560308 gbpln1445.se 777015504 gbpln1446.se 1455593679 gbpln1447.se 1455711383 gbpln1448.se 838785071 gbpln1449.se 1436107193 gbpln145.seq 791233293 gbpln1450.se 770014685 gbpln1451.se 1450013191 gbpln1452.se 1455309450 gbpln1453.se 835677720 gbpln1454.se 793372574 gbpln1455.se 769401747 gbpln1456.se 1456544663 gbpln1457.se 1465313453 gbpln1458.se 839230685 gbpln1459.se 1434914798 gbpln146.seq 803963907 gbpln1460.se 778586682 gbpln1461.se 1463130395 gbpln1462.se 1457728697 gbpln1463.se 832496071 gbpln1464.se 797513192 gbpln1465.se 776551156 gbpln1466.se 1449845840 gbpln1467.se 1460493739 gbpln1468.se 839860091 gbpln1469.se 1494413615 gbpln147.seq 789840368 gbpln1470.se 776969912 gbpln1471.se 1450486337 gbpln1472.se 1492412414 gbpln1473.se 1486347390 gbpln1474.se 1445734827 gbpln1475.se 1251330037 gbpln1476.se 1123381446 gbpln1477.se 1111693114 gbpln1478.se 1309334197 gbpln1479.se 1497175490 gbpln148.seq 1445887647 gbpln1480.se 1075129462 gbpln1481.se 830295693 gbpln1482.se 794035728 gbpln1483.se 766241777 gbpln1484.se 1451959155 gbpln1485.se 1460262157 gbpln1486.se 800420442 gbpln1487.se 807100878 gbpln1488.se 813165275 gbpln1489.se 1409254471 gbpln149.seq 1489858794 gbpln1490.se 1463645427 gbpln1491.se 836403024 gbpln1492.se 797704105 gbpln1493.se 771673145 gbpln1494.se 1489073756 gbpln1495.se 1463000631 gbpln1496.se 835021187 gbpln1497.se 794511065 gbpln1498.se 765022160 gbpln1499.se 1399719926 gbpln15.seq 1488745664 gbpln150.seq 1450430115 gbpln1500.se 1446394723 gbpln1501.se 837987830 gbpln1502.se 795104781 gbpln1503.se 772053911 gbpln1504.se 1454341387 gbpln1505.se 1471789751 gbpln1506.se 850379386 gbpln1507.se 1235921753 gbpln1508.se 820640783 gbpln1509.se 1491155922 gbpln151.seq 1480995730 gbpln1510.se 791665139 gbpln1511.se 942729894 gbpln1512.se 1413075322 gbpln1513.se 1271936167 gbpln1514.se 1485569282 gbpln1515.se 1184860642 gbpln1516.se 1227021384 gbpln1517.se 774221642 gbpln1518.se 1442418481 gbpln1519.se 1487664054 gbpln152.seq 1485783848 gbpln1520.se 1496789915 gbpln1521.se 830664198 gbpln1522.se 1288415270 gbpln1523.se 1169137619 gbpln1524.se 1155060741 gbpln1525.se 1106694171 gbpln1526.se 743643037 gbpln1527.se 813798059 gbpln1528.se 917254577 gbpln1529.se 1473087961 gbpln153.seq 779958775 gbpln1530.se 1485214817 gbpln1531.se 1278353436 gbpln1532.se 1139679372 gbpln1533.se 984761113 gbpln1534.se 1283374413 gbpln1535.se 1150069921 gbpln1536.se 1317039690 gbpln1537.se 1197197872 gbpln1538.se 1347095234 gbpln1539.se 1479878771 gbpln154.seq 804969230 gbpln1540.se 926159519 gbpln1541.se 792460446 gbpln1542.se 801108478 gbpln1543.se 1328275496 gbpln1544.se 1268424943 gbpln1545.se 1138984600 gbpln1546.se 933347957 gbpln1547.se 1302091924 gbpln1548.se 1175546336 gbpln1549.se 1471618414 gbpln155.seq 1181953737 gbpln1550.se 1208933793 gbpln1551.se 744501950 gbpln1552.se 805611990 gbpln1553.se 924158932 gbpln1554.se 775406984 gbpln1555.se 805742787 gbpln1556.se 1306402660 gbpln1557.se 1267536627 gbpln1558.se 1185840762 gbpln1559.se 1441042972 gbpln156.seq 1469693579 gbpln1560.se 1160496025 gbpln1561.se 840478319 gbpln1562.se 804862544 gbpln1563.se 775136193 gbpln1564.se 1456887584 gbpln1565.se 1470716689 gbpln1566.se 836948259 gbpln1567.se 794972859 gbpln1568.se 775455598 gbpln1569.se 1450942400 gbpln157.seq 1463119445 gbpln1570.se 1451301195 gbpln1571.se 852997313 gbpln1572.se 798187575 gbpln1573.se 776406263 gbpln1574.se 1458385249 gbpln1575.se 1463826120 gbpln1576.se 833048862 gbpln1577.se 794071582 gbpln1578.se 772684697 gbpln1579.se 1482863698 gbpln158.seq 1454827832 gbpln1580.se 1451661085 gbpln1581.se 839152730 gbpln1582.se 798464996 gbpln1583.se 775710033 gbpln1584.se 1463986968 gbpln1585.se 1455516963 gbpln1586.se 827472017 gbpln1587.se 799696373 gbpln1588.se 771541363 gbpln1589.se 1498496390 gbpln159.seq 1456098533 gbpln1590.se 1450468258 gbpln1591.se 830011447 gbpln1592.se 803324869 gbpln1593.se 778613518 gbpln1594.se 1485535574 gbpln1595.se 1460285834 gbpln1596.se 834396522 gbpln1597.se 793156442 gbpln1598.se 771664945 gbpln1599.se 1419955350 gbpln16.seq 1449957397 gbpln160.seq 1460976066 gbpln1600.se 1472747650 gbpln1601.se 831402033 gbpln1602.se 788227480 gbpln1603.se 773608315 gbpln1604.se 1459251214 gbpln1605.se 1457115869 gbpln1606.se 833114761 gbpln1607.se 791988363 gbpln1608.se 773778680 gbpln1609.se 1479709082 gbpln161.seq 1439338108 gbpln1610.se 1459678216 gbpln1611.se 832582978 gbpln1612.se 790630518 gbpln1613.se 774554078 gbpln1614.se 1459431387 gbpln1615.se 1462622889 gbpln1616.se 841885928 gbpln1617.se 814740283 gbpln1618.se 781686950 gbpln1619.se 1488571927 gbpln162.seq 1470777020 gbpln1620.se 1474113031 gbpln1621.se 836345572 gbpln1622.se 803943397 gbpln1623.se 776352617 gbpln1624.se 1461742228 gbpln1625.se 1468260082 gbpln1626.se 833628952 gbpln1627.se 800337028 gbpln1628.se 775679569 gbpln1629.se 1479524806 gbpln163.seq 1485372410 gbpln1630.se 1470684487 gbpln1631.se 837791026 gbpln1632.se 805450455 gbpln1633.se 782697461 gbpln1634.se 1462403294 gbpln1635.se 1471545155 gbpln1636.se 844251896 gbpln1637.se 800661389 gbpln1638.se 770104661 gbpln1639.se 1489084396 gbpln164.seq 1486820730 gbpln1640.se 1437673274 gbpln1641.se 1478905630 gbpln1642.se 1484038098 gbpln1643.se 1459847462 gbpln1644.se 1419010411 gbpln1645.se 1449294852 gbpln1646.se 1432942330 gbpln1647.se 1483752514 gbpln1648.se 1440643790 gbpln1649.se 1497006518 gbpln165.seq 1404423649 gbpln1650.se 1444711390 gbpln1651.se 1488511554 gbpln1652.se 1472105081 gbpln1653.se 1252858539 gbpln1654.se 1227118965 gbpln1655.se 1253367586 gbpln1656.se 1312280922 gbpln1657.se 1221593375 gbpln1658.se 1480321489 gbpln1659.se 1432863736 gbpln166.seq 1413447705 gbpln1660.se 1469526349 gbpln1661.se 1268059371 gbpln1662.se 2734223096 gbpln1663.se 2727931901 gbpln1664.se 2720692598 gbpln1665.se 2732441076 gbpln1666.se 2733260927 gbpln1667.se 157556535 gbpln1668.se 2694271430 gbpln1669.se 1443905484 gbpln167.seq 2735442486 gbpln1670.se 2720859722 gbpln1671.se 2732011308 gbpln1672.se 2383529845 gbpln1673.se 2723191931 gbpln1674.se 2689474086 gbpln1675.se 2737751830 gbpln1676.se 2700210160 gbpln1677.se 2006289519 gbpln1678.se 2636141786 gbpln1679.se 1275021457 gbpln168.seq 2722875815 gbpln1680.se 2725415454 gbpln1681.se 2730393002 gbpln1682.se 1948886785 gbpln1683.se 2738131093 gbpln1684.se 2727379378 gbpln1685.se 2679871098 gbpln1686.se 2737685310 gbpln1687.se 786720890 gbpln1688.se 2727907345 gbpln1689.se 1226543968 gbpln169.seq 2657432129 gbpln1690.se 2735229991 gbpln1691.se 2728645371 gbpln1692.se 218791011 gbpln1693.se 2719617838 gbpln1694.se 2721885171 gbpln1695.se 2721092581 gbpln1696.se 2679558604 gbpln1697.se 181580803 gbpln1698.se 2722179116 gbpln1699.se 1415252675 gbpln17.seq 1430811768 gbpln170.seq 2736369220 gbpln1700.se 2726783046 gbpln1701.se 2440060122 gbpln1702.se 2736724965 gbpln1703.se 2696541624 gbpln1704.se 2737924301 gbpln1705.se 1979539878 gbpln1706.se 2731302183 gbpln1707.se 2702984894 gbpln1708.se 2732485324 gbpln1709.se 1482273215 gbpln171.seq 1906858977 gbpln1710.se 1333776538 gbpln1711.se 1481529082 gbpln1712.se 1126988286 gbpln1713.se 1310090641 gbpln1714.se 1319048578 gbpln1715.se 1215502439 gbpln1716.se 1273213184 gbpln1717.se 1439841247 gbpln1718.se 1291263007 gbpln1719.se 1491770215 gbpln172.seq 1286241557 gbpln1720.se 1294607816 gbpln1721.se 1298830856 gbpln1722.se 1179380341 gbpln1723.se 1227809389 gbpln1724.se 1347974809 gbpln1725.se 1227045645 gbpln1726.se 1241387178 gbpln1727.se 1321199139 gbpln1728.se 1307076096 gbpln1729.se 1473757601 gbpln173.seq 1194598426 gbpln1730.se 1267961203 gbpln1731.se 1465598311 gbpln1732.se 1272760531 gbpln1733.se 1248554044 gbpln1734.se 1285502181 gbpln1735.se 1353649948 gbpln1736.se 1201259963 gbpln1737.se 1114385426 gbpln1738.se 1428292861 gbpln1739.se 1465338635 gbpln174.seq 1254591123 gbpln1740.se 1109371533 gbpln1741.se 1256013571 gbpln1742.se 1193254570 gbpln1743.se 1147797532 gbpln1744.se 1185963587 gbpln1745.se 1176623547 gbpln1746.se 1184486862 gbpln1747.se 1178497787 gbpln1748.se 1255058840 gbpln1749.se 1418290908 gbpln175.seq 1121066110 gbpln1750.se 1150746117 gbpln1751.se 1179251584 gbpln1752.se 1319824235 gbpln1753.se 1194499724 gbpln1754.se 1150884296 gbpln1755.se 1260272463 gbpln1756.se 1277796253 gbpln1757.se 1077009674 gbpln1758.se 1159931138 gbpln1759.se 1471011443 gbpln176.seq 1298671968 gbpln1760.se 1092881836 gbpln1761.se 1120436749 gbpln1762.se 1214127482 gbpln1763.se 1117793566 gbpln1764.se 1019835843 gbpln1765.se 1155398206 gbpln1766.se 1368620545 gbpln1767.se 1144165985 gbpln1768.se 1072391985 gbpln1769.se 1453823805 gbpln177.seq 1263097017 gbpln1770.se 1297997059 gbpln1771.se 1325335044 gbpln1772.se 1216230084 gbpln1773.se 1263623363 gbpln1774.se 1174025244 gbpln1775.se 1229634718 gbpln1776.se 1363681878 gbpln1777.se 1218381112 gbpln1778.se 1400966271 gbpln1779.se 1492185565 gbpln178.seq 1382372150 gbpln1780.se 1176735774 gbpln1781.se 1224889930 gbpln1782.se 1310436934 gbpln1783.se 1233749942 gbpln1784.se 1059964644 gbpln1785.se 1254488223 gbpln1786.se 1310744622 gbpln1787.se 1163904965 gbpln1788.se 1264654503 gbpln1789.se 1491878684 gbpln179.seq 1296551517 gbpln1790.se 1158563945 gbpln1791.se 1059918971 gbpln1792.se 1259052983 gbpln1793.se 1206631634 gbpln1794.se 1106849019 gbpln1795.se 1193454949 gbpln1796.se 1254210685 gbpln1797.se 1151910983 gbpln1798.se 1118028517 gbpln1799.se 1377958226 gbpln18.seq 1479401108 gbpln180.seq 1136283639 gbpln1800.se 1270471759 gbpln1801.se 1106145822 gbpln1802.se 1237358153 gbpln1803.se 1388485833 gbpln1804.se 1221364282 gbpln1805.se 1101728075 gbpln1806.se 1191208317 gbpln1807.se 1212231259 gbpln1808.se 1132007157 gbpln1809.se 1472733184 gbpln181.seq 1441955987 gbpln1810.se 1470274017 gbpln1811.se 1459739391 gbpln1812.se 1471760010 gbpln1813.se 1440847993 gbpln1814.se 1455978021 gbpln1815.se 1445045468 gbpln1816.se 1487079619 gbpln1817.se 1481625137 gbpln1818.se 1447279987 gbpln1819.se 1467968927 gbpln182.seq 1048521857 gbpln1820.se 1038155665 gbpln1821.se 833369930 gbpln1822.se 931292869 gbpln1823.se 811379792 gbpln1824.se 1077992453 gbpln1825.se 812614257 gbpln1826.se 1052276453 gbpln1827.se 1035793516 gbpln1828.se 832863081 gbpln1829.se 1494168283 gbpln183.seq 922247165 gbpln1830.se 807661527 gbpln1831.se 1066166824 gbpln1832.se 997697986 gbpln1833.se 1273669998 gbpln1834.se 1102521608 gbpln1835.se 1209618371 gbpln1836.se 1111089963 gbpln1837.se 1160173863 gbpln1838.se 1205643923 gbpln1839.se 1113648000 gbpln184.seq 1237074429 gbpln1840.se 1242683281 gbpln1841.se 1080809951 gbpln1842.se 1226448377 gbpln1843.se 1349517074 gbpln1844.se 1175767295 gbpln1845.se 1216393612 gbpln1846.se 1294608106 gbpln1847.se 1298831146 gbpln1848.se 1179380631 gbpln1849.se 968800022 gbpln185.seq 1227809679 gbpln1850.se 1347975099 gbpln1851.se 1227045935 gbpln1852.se 1241387663 gbpln1853.se 1256013573 gbpln1854.se 1193254572 gbpln1855.se 1147797534 gbpln1856.se 1185963589 gbpln1857.se 1176623549 gbpln1858.se 1184486864 gbpln1859.se 847363373 gbpln186.seq 1178497789 gbpln1860.se 1255058842 gbpln1861.se 1121066112 gbpln1862.se 1150746119 gbpln1863.se 1179251586 gbpln1864.se 1319824237 gbpln1865.se 1194499726 gbpln1866.se 1150884349 gbpln1867.se 1183507690 gbpln1868.se 1165156001 gbpln1869.se 1005397162 gbpln187.seq 1145365871 gbpln1870.se 1114264316 gbpln1871.se 1291707339 gbpln1872.se 1200907808 gbpln1873.se 1185642828 gbpln1874.se 1268692726 gbpln1875.se 1272919740 gbpln1876.se 1103058293 gbpln1877.se 1122948169 gbpln1878.se 1380211964 gbpln1879.se 963947957 gbpln188.seq 1129155752 gbpln1880.se 1160577179 gbpln1881.se 1260272465 gbpln1882.se 1277796255 gbpln1883.se 1077009676 gbpln1884.se 1159931140 gbpln1885.se 1298671970 gbpln1886.se 1092881838 gbpln1887.se 1120436751 gbpln1888.se 1214127484 gbpln1889.se 1459632274 gbpln189.seq 1117793568 gbpln1890.se 1019835845 gbpln1891.se 1155398208 gbpln1892.se 1368620547 gbpln1893.se 1144165987 gbpln1894.se 1072392038 gbpln1895.se 1310090643 gbpln1896.se 1319048580 gbpln1897.se 1215502441 gbpln1898.se 1273213186 gbpln1899.se 1388122211 gbpln19.seq 748612447 gbpln190.seq 1439841249 gbpln1900.se 1291263009 gbpln1901.se 1286241610 gbpln1902.se 1263097019 gbpln1903.se 1297997061 gbpln1904.se 1325335047 gbpln1905.se 1216230086 gbpln1906.se 1263623365 gbpln1907.se 1174025246 gbpln1908.se 1229634720 gbpln1909.se 952879508 gbpln191.seq 1363681880 gbpln1910.se 1218381114 gbpln1911.se 1400966274 gbpln1912.se 1382372152 gbpln1913.se 1176735776 gbpln1914.se 1259998472 gbpln1915.se 1429872810 gbpln1916.se 1290195552 gbpln1917.se 1118855412 gbpln1918.se 1286015571 gbpln1919.se 925770946 gbpln192.seq 1309057752 gbpln1920.se 1189205456 gbpln1921.se 1088738989 gbpln1922.se 1310436046 gbpln1923.se 1233749054 gbpln1924.se 1059963756 gbpln1925.se 1254487335 gbpln1926.se 1310743734 gbpln1927.se 1233633287 gbpln1928.se 1257623330 gbpln1929.se 679052844 gbpln193.seq 1136790411 gbpln1930.se 1024083293 gbpln1931.se 1208012116 gbpln1932.se 1341166334 gbpln1933.se 1178296123 gbpln1934.se 1133776595 gbpln1935.se 1321198791 gbpln1936.se 1307075748 gbpln1937.se 1194598078 gbpln1938.se 1267960855 gbpln1939.se 891360722 gbpln194.seq 1465597963 gbpln1940.se 1272760183 gbpln1941.se 1248553572 gbpln1942.se 997697304 gbpln1943.se 1273669316 gbpln1944.se 1102520926 gbpln1945.se 1209617689 gbpln1946.se 1111089281 gbpln1947.se 1160173181 gbpln1948.se 1205643241 gbpln1949.se 983898394 gbpln195.seq 1237073747 gbpln1950.se 1242682599 gbpln1951.se 1080809269 gbpln1952.se 1226447695 gbpln1953.se 1349516392 gbpln1954.se 1175766613 gbpln1955.se 1216392639 gbpln1956.se 1306535163 gbpln1957.se 1471600767 gbpln1958.se 1474480099 gbpln1959.se 816632398 gbpln196.seq 1442648460 gbpln1960.se 1445144746 gbpln1961.se 1470808103 gbpln1962.se 1400146166 gbpln1963.se 1451194528 gbpln1964.se 1491931525 gbpln1965.se 1485075954 gbpln1966.se 1464218638 gbpln1967.se 1464354463 gbpln1968.se 1434708681 gbpln1969.se 1120135514 gbpln197.seq 1446304634 gbpln1970.se 1481913454 gbpln1971.se 225362530 gbpln1972.se 2549738660 gbpln1973.se 1967027328 gbpln1974.se 1908341558 gbpln1975.se 1899626925 gbpln1976.se 1507440270 gbpln1977.se 1195338085 gbpln1978.se 1471685994 gbpln1979.se 972750007 gbpln198.seq 1482480163 gbpln1980.se 1457506232 gbpln1981.se 1489313455 gbpln1982.se 1496792810 gbpln1983.se 997934006 gbpln1984.se 832020729 gbpln1985.se 803030138 gbpln1986.se 771628223 gbpln1987.se 1448711979 gbpln1988.se 1240387718 gbpln1989.se 850229495 gbpln199.seq 1254120972 gbpln1990.se 1355940856 gbpln1991.se 1218508495 gbpln1992.se 1405315859 gbpln1993.se 971627123 gbpln1994.se 850272715 gbpln1995.se 849609082 gbpln1996.se 850190924 gbpln1997.se 976829654 gbpln1998.se 814643125 gbpln1999.se 1499992827 gbpln2.seq 1414821162 gbpln20.seq 1055433981 gbpln200.seq 879514342 gbpln2000.se 812317704 gbpln2001.se 1488237027 gbpln2002.se 944480603 gbpln2003.se 1488070952 gbpln2004.se 1495294095 gbpln2005.se 1496264712 gbpln2006.se 1489792519 gbpln2007.se 1231600086 gbpln2008.se 1265330191 gbpln2009.se 1010019267 gbpln201.seq 1488619274 gbpln2010.se 1499872978 gbpln2011.se 1330362925 gbpln2012.se 1240461713 gbpln2013.se 1332036329 gbpln2014.se 1277787876 gbpln2015.se 1478171319 gbpln2016.se 1308033872 gbpln2017.se 1388656433 gbpln2018.se 1443471168 gbpln2019.se 649020885 gbpln202.seq 1413408953 gbpln2020.se 548537029 gbpln2021.se 1225077540 gbpln2022.se 720006506 gbpln2023.se 919172207 gbpln2024.se 874099574 gbpln2025.se 897784209 gbpln2026.se 876816866 gbpln2027.se 928190381 gbpln2028.se 951802003 gbpln2029.se 926976463 gbpln203.seq 824940722 gbpln2030.se 1489306195 gbpln2031.se 1440059389 gbpln2032.se 1482984720 gbpln2033.se 1486345764 gbpln2034.se 1467103047 gbpln2035.se 1478834238 gbpln2036.se 1444208472 gbpln2037.se 1483418769 gbpln2038.se 1450848094 gbpln2039.se 1429445579 gbpln204.seq 1437772699 gbpln2040.se 1444817012 gbpln2041.se 1489000224 gbpln2042.se 1446871084 gbpln2043.se 1494839831 gbpln2044.se 1496741541 gbpln2045.se 1374411960 gbpln2046.se 1182248511 gbpln2047.se 1497598843 gbpln2048.se 1491491565 gbpln2049.se 1395283641 gbpln205.seq 1461709979 gbpln2050.se 1449889995 gbpln2051.se 1495849942 gbpln2052.se 1484634302 gbpln2053.se 1412074936 gbpln2054.se 1405761405 gbpln2055.se 1402453546 gbpln2056.se 1455644102 gbpln2057.se 1455814532 gbpln2058.se 1446114329 gbpln2059.se 1354945307 gbpln206.seq 1446417320 gbpln2060.se 917155032 gbpln2061.se 1344094817 gbpln2062.se 1494221955 gbpln2063.se 1499592864 gbpln2064.se 1412833349 gbpln2065.se 1483609453 gbpln2066.se 1452520406 gbpln2067.se 1397047033 gbpln2068.se 1363158169 gbpln2069.se 1483269401 gbpln207.seq 1095290873 gbpln2070.se 1254083690 gbpln2071.se 1125915727 gbpln2072.se 1182820897 gbpln2073.se 1211366234 gbpln2074.se 746226311 gbpln2075.se 808684301 gbpln2076.se 907082750 gbpln2077.se 776688096 gbpln2078.se 1492097759 gbpln2079.se 1328920351 gbpln208.seq 1287386524 gbpln2080.se 1186027136 gbpln2081.se 1009876181 gbpln2082.se 1184603147 gbpln2083.se 1464753704 gbpln2084.se 1494750327 gbpln2085.se 1476871635 gbpln2086.se 1468324176 gbpln2087.se 1402431982 gbpln2088.se 1429782007 gbpln2089.se 1375810615 gbpln209.seq 1449842921 gbpln2090.se 1191589738 gbpln2091.se 1497010592 gbpln2092.se 1315701164 gbpln2093.se 1281309867 gbpln2094.se 1477284423 gbpln2095.se 1484711099 gbpln2096.se 1472609216 gbpln2097.se 1441438443 gbpln2098.se 1296128182 gbpln2099.se 1469241166 gbpln21.seq 1417059620 gbpln210.seq 1242756216 gbpln2100.se 1236451481 gbpln2101.se 1161997519 gbpln2102.se 1077270122 gbpln2103.se 1063033182 gbpln2104.se 1035836409 gbpln2105.se 1035095741 gbpln2106.se 1031633368 gbpln2107.se 978748070 gbpln2108.se 979040203 gbpln2109.se 1445203849 gbpln211.seq 970030251 gbpln2110.se 965223890 gbpln2111.se 968357696 gbpln2112.se 1280850671 gbpln2113.se 1277873606 gbpln2114.se 1033073499 gbpln2115.se 1255917596 gbpln2116.se 1033902901 gbpln2117.se 1338307356 gbpln2118.se 1253985607 gbpln2119.se 1390731093 gbpln212.seq 1211059423 gbpln2120.se 1165332095 gbpln2121.se 1473761940 gbpln2122.se 1478507707 gbpln2123.se 1406604626 gbpln2124.se 748543111 gbpln2125.se 2550219564 gbpln2126.se 1934626598 gbpln2127.se 2273083779 gbpln2128.se 2195238735 gbpln2129.se 1497962930 gbpln213.seq 2182093040 gbpln2130.se 1808875390 gbpln2131.se 2021331230 gbpln2132.se 1497753716 gbpln2133.se 1490455213 gbpln2134.se 1478099039 gbpln2135.se 1325651304 gbpln2136.se 1449537429 gbpln2137.se 878967187 gbpln2138.se 1355240074 gbpln2139.se 1455153046 gbpln214.seq 1480516716 gbpln2140.se 1497401673 gbpln2141.se 1490481944 gbpln2142.se 1420494202 gbpln2143.se 1392744913 gbpln2144.se 1498251308 gbpln2145.se 1248523234 gbpln2146.se 1455420277 gbpln2147.se 1417475415 gbpln2148.se 1382790154 gbpln2149.se 1478219408 gbpln215.seq 1392095099 gbpln2150.se 1438579339 gbpln2151.se 1435206085 gbpln2152.se 1438544862 gbpln2153.se 1473935824 gbpln2154.se 1447579851 gbpln2155.se 1397452636 gbpln2156.se 1202495428 gbpln2157.se 1159422590 gbpln2158.se 1142132932 gbpln2159.se 1455380374 gbpln216.seq 1041331622 gbpln2160.se 957152555 gbpln2161.se 1081839501 gbpln2162.se 1445552919 gbpln2163.se 1319425564 gbpln2164.se 1268533720 gbpln2165.se 1109648066 gbpln2166.se 1486506812 gbpln2167.se 1497707399 gbpln2168.se 1422234742 gbpln2169.se 1487477494 gbpln217.seq 1489590944 gbpln2170.se 1478227947 gbpln2171.se 1402602326 gbpln2172.se 1491762551 gbpln2173.se 1484377526 gbpln2174.se 1397644911 gbpln2175.se 1489605217 gbpln2176.se 1479854682 gbpln2177.se 1498479466 gbpln2178.se 1461142286 gbpln2179.se 1468006969 gbpln218.seq 1042087100 gbpln2180.se 1112183793 gbpln2181.se 1489968340 gbpln2182.se 1244442524 gbpln2183.se 1433366576 gbpln2184.se 1476620950 gbpln2185.se 1383029421 gbpln2186.se 1407240135 gbpln2187.se 823995636 gbpln2188.se 779758590 gbpln2189.se 1420832667 gbpln219.seq 767138463 gbpln2190.se 1459415295 gbpln2191.se 1318422290 gbpln2192.se 809577106 gbpln2193.se 767635813 gbpln2194.se 1472481285 gbpln2195.se 1489014285 gbpln2196.se 1470984315 gbpln2197.se 783356383 gbpln2198.se 768556688 gbpln2199.se 1330335968 gbpln22.seq 1474550998 gbpln220.seq 1437743364 gbpln2200.se 1455697771 gbpln2201.se 827116263 gbpln2202.se 785947999 gbpln2203.se 765845200 gbpln2204.se 1449229608 gbpln2205.se 1406361789 gbpln2206.se 789953322 gbpln2207.se 1476310111 gbpln2208.se 1381424733 gbpln2209.se 1377391218 gbpln221.seq 1399187032 gbpln2210.se 828245843 gbpln2211.se 784946746 gbpln2212.se 762930721 gbpln2213.se 1442020097 gbpln2214.se 1446746274 gbpln2215.se 839668894 gbpln2216.se 780847594 gbpln2217.se 766352668 gbpln2218.se 1433384069 gbpln2219.se 1486201224 gbpln222.seq 1448399892 gbpln2220.se 830761006 gbpln2221.se 781576153 gbpln2222.se 770532847 gbpln2223.se 1451368039 gbpln2224.se 1468486682 gbpln2225.se 1422478456 gbpln2226.se 1209600917 gbpln2227.se 1305650736 gbpln2228.se 1499569179 gbpln2229.se 1467677664 gbpln223.seq 1479564077 gbpln2230.se 1310990192 gbpln2231.se 936978374 gbpln2232.se 920269142 gbpln2233.se 883112886 gbpln2234.se 832543127 gbpln2235.se 1498872025 gbpln2236.se 1476600034 gbpln2237.se 952864124 gbpln2238.se 787768428 gbpln2239.se 1450443416 gbpln224.seq 1428009130 gbpln2240.se 755534147 gbpln2241.se 1480075799 gbpln2242.se 1469630574 gbpln2243.se 1183968868 gbpln2244.se 1240337921 gbpln2245.se 1318956426 gbpln2246.se 1188612750 gbpln2247.se 1366623424 gbpln2248.se 1335947050 gbpln2249.se 1491884245 gbpln225.seq 1266251080 gbpln2250.se 1452821372 gbpln2251.se 780043579 gbpln2252.se 905109697 gbpln2253.se 1382989945 gbpln2254.se 1232904489 gbpln2255.se 1440154507 gbpln2256.se 1168370460 gbpln2257.se 1199443118 gbpln2258.se 750912628 gbpln2259.se 1479976090 gbpln226.seq 1409081348 gbpln2260.se 1372629865 gbpln2261.se 1289745020 gbpln2262.se 1460865783 gbpln2263.se 790728913 gbpln2264.se 902369485 gbpln2265.se 1398303546 gbpln2266.se 1242706260 gbpln2267.se 1477910015 gbpln2268.se 1187286228 gbpln2269.se 1495012785 gbpln227.seq 1216892597 gbpln2270.se 766048148 gbpln2271.se 1427747667 gbpln2272.se 1106685227 gbpln2273.se 1292772070 gbpln2274.se 1473277348 gbpln2275.se 777806550 gbpln2276.se 904373545 gbpln2277.se 1394073651 gbpln2278.se 1233880506 gbpln2279.se 1477640990 gbpln228.seq 1459908076 gbpln2280.se 1180874775 gbpln2281.se 1206127533 gbpln2282.se 758800773 gbpln2283.se 1411529100 gbpln2284.se 1387878786 gbpln2285.se 1325614562 gbpln2286.se 832981423 gbpln2287.se 1483690500 gbpln2288.se 936519560 gbpln2289.se 1497533487 gbpln229.seq 1398720843 gbpln2290.se 1273969273 gbpln2291.se 746940224 gbpln2292.se 1330513343 gbpln2293.se 1419517789 gbpln2294.se 1259825477 gbpln2295.se 1467013139 gbpln2296.se 1370316893 gbpln2297.se 1327491284 gbpln2298.se 1458052505 gbpln2299.se 1178137445 gbpln23.seq 1483521124 gbpln230.seq 810878641 gbpln2300.se 918649155 gbpln2301.se 1433445081 gbpln2302.se 1271720643 gbpln2303.se 748996652 gbpln2304.se 1343147371 gbpln2305.se 1436210064 gbpln2306.se 1276333919 gbpln2307.se 1463171568 gbpln2308.se 1340622538 gbpln2309.se 1485233793 gbpln231.seq 1261445928 gbpln2310.se 1462632664 gbpln2311.se 786147800 gbpln2312.se 922710021 gbpln2313.se 1372350245 gbpln2314.se 1249995715 gbpln2315.se 1491765656 gbpln2316.se 1180176762 gbpln2317.se 1225306778 gbpln2318.se 762120080 gbpln2319.se 1458973299 gbpln232.seq 1461974404 gbpln2320.se 1457333176 gbpln2321.se 1492022178 gbpln2322.se 1476792845 gbpln2323.se 972956120 gbpln2324.se 868135626 gbpln2325.se 882846708 gbpln2326.se 797751492 gbpln2327.se 806424564 gbpln2328.se 733757147 gbpln2329.se 1498950818 gbpln233.seq 1451063550 gbpln2330.se 1188400824 gbpln2331.se 1492229759 gbpln2332.se 1494148710 gbpln2333.se 1489022316 gbpln2334.se 950703988 gbpln2335.se 883495278 gbpln2336.se 907591334 gbpln2337.se 810354788 gbpln2338.se 805672920 gbpln2339.se 1471059352 gbpln234.seq 742834347 gbpln2340.se 1485923833 gbpln2341.se 1499986349 gbpln2342.se 1478169702 gbpln2343.se 1488030531 gbpln2344.se 1492737370 gbpln2345.se 1463244561 gbpln2346.se 1456614467 gbpln2347.se 1459607956 gbpln2348.se 1445674110 gbpln2349.se 1471338277 gbpln235.seq 1461086753 gbpln2350.se 1481995846 gbpln2351.se 1460751139 gbpln2352.se 1430518238 gbpln2353.se 1413090078 gbpln2354.se 1270480900 gbpln2355.se 1141914774 gbpln2356.se 927867625 gbpln2357.se 1431042664 gbpln2358.se 1379009636 gbpln2359.se 1497265656 gbpln236.seq 1326487930 gbpln2360.se 1292059993 gbpln2361.se 1226033834 gbpln2362.se 1062596938 gbpln2363.se 887282416 gbpln2364.se 880396180 gbpln2365.se 1458445116 gbpln2366.se 1229013764 gbpln2367.se 1493751580 gbpln2368.se 1498429867 gbpln2369.se 1491520128 gbpln237.seq 1485955822 gbpln2370.se 1432654628 gbpln2371.se 1460754289 gbpln2372.se 1443249722 gbpln2373.se 1431829288 gbpln2374.se 1019856776 gbpln2375.se 926829963 gbpln2376.se 631978811 gbpln2377.se 1007025956 gbpln2378.se 1015784082 gbpln2379.se 1499998626 gbpln238.seq 849865988 gbpln2380.se 961335938 gbpln2381.se 1101841304 gbpln2382.se 807661531 gbpln2383.se 965168115 gbpln2384.se 876245218 gbpln2385.se 676215233 gbpln2386.se 908511369 gbpln2387.se 934941423 gbpln2388.se 737378330 gbpln2389.se 1499999514 gbpln239.seq 789038594 gbpln2390.se 944965471 gbpln2391.se 639676369 gbpln2392.se 956064578 gbpln2393.se 971671783 gbpln2394.se 1495611181 gbpln2395.se 1438689934 gbpln2396.se 1447349888 gbpln2397.se 1072443076 gbpln2398.se 1392610943 gbpln2399.se 1189405382 gbpln24.seq 1499093373 gbpln240.seq 1218955498 gbpln2400.se 1497284494 gbpln2401.se 1489668771 gbpln2402.se 1412101378 gbpln2403.se 1379792366 gbpln2404.se 1319894800 gbpln2405.se 1261901829 gbpln2406.se 1471965176 gbpln2407.se 1438337816 gbpln2408.se 1255789880 gbpln2409.se 1499997523 gbpln241.seq 1279146690 gbpln2410.se 1495918934 gbpln2411.se 1455909107 gbpln2412.se 1470157321 gbpln2413.se 1483914736 gbpln2414.se 1472116203 gbpln2415.se 1492061364 gbpln2416.se 1493038560 gbpln2417.se 1475560127 gbpln2418.se 1496073973 gbpln2419.se 1449879282 gbpln242.seq 1485816916 gbpln2420.se 1014631571 gbpln2421.se 831368003 gbpln2422.se 825264489 gbpln2423.se 815981406 gbpln2424.se 1428426310 gbpln2425.se 1277942052 gbpln2426.se 845848234 gbpln2427.se 819614592 gbpln2428.se 799993226 gbpln2429.se 1438159966 gbpln243.seq 1406794075 gbpln2430.se 1268786306 gbpln2431.se 1211772007 gbpln2432.se 1156911804 gbpln2433.se 1037250057 gbpln2434.se 1422953573 gbpln2435.se 1489668639 gbpln2436.se 1400546300 gbpln2437.se 1401350158 gbpln2438.se 1471861686 gbpln2439.se 1456391013 gbpln244.seq 1221871381 gbpln2440.se 1087860182 gbpln2441.se 1047598051 gbpln2442.se 1361330733 gbpln2443.se 1493342303 gbpln2444.se 886124102 gbpln2445.se 1344116512 gbpln2446.se 1191896435 gbpln2447.se 1123667252 gbpln2448.se 1389152081 gbpln2449.se 1181142317 gbpln245.seq 1302137889 gbpln2450.se 1496151287 gbpln2451.se 1455420575 gbpln2452.se 1462105309 gbpln2453.se 1397413355 gbpln2454.se 1435077892 gbpln2455.se 1450949136 gbpln2456.se 1441524092 gbpln2457.se 1397949882 gbpln2458.se 1428504381 gbpln2459.se 786074578 gbpln246.seq 1443291228 gbpln2460.se 1432178510 gbpln2461.se 1485345653 gbpln2462.se 1386378899 gbpln2463.se 1394543158 gbpln2464.se 1493043632 gbpln2465.se 1473164557 gbpln2466.se 1490017290 gbpln2467.se 1467442997 gbpln2468.se 1473297085 gbpln2469.se 1469406697 gbpln247.seq 1390399030 gbpln2470.se 1426468984 gbpln2471.se 1494173373 gbpln2472.se 1495630090 gbpln2473.se 1468187496 gbpln2474.se 1141716250 gbpln2475.se 1338382354 gbpln2476.se 1228737712 gbpln2477.se 1489418744 gbpln2478.se 1438554719 gbpln2479.se 1351709444 gbpln248.seq 1445094269 gbpln2480.se 1439364293 gbpln2481.se 1107668741 gbpln2482.se 798759393 gbpln2483.se 787037423 gbpln2484.se 1484847618 gbpln2485.se 1361568320 gbpln2486.se 788748892 gbpln2487.se 785913492 gbpln2488.se 1490791926 gbpln2489.se 1499970877 gbpln249.seq 1417470317 gbpln2490.se 1424915317 gbpln2491.se 1368450119 gbpln2492.se 1304767104 gbpln2493.se 1105675676 gbpln2494.se 1334015175 gbpln2495.se 1319534780 gbpln2496.se 1446254066 gbpln2497.se 1390445134 gbpln2498.se 1245417644 gbpln2499.se 1381436972 gbpln25.seq 1499998115 gbpln250.seq 1450539615 gbpln2500.se 1476335104 gbpln2501.se 1436673260 gbpln2502.se 1326822143 gbpln2503.se 1382769597 gbpln2504.se 1496188571 gbpln2505.se 1294179784 gbpln2506.se 1470659234 gbpln2507.se 1389250438 gbpln2508.se 1447565968 gbpln2509.se 1499998809 gbpln251.seq 1224096885 gbpln2510.se 1410658795 gbpln2511.se 1460483293 gbpln2512.se 1447228243 gbpln2513.se 1286292170 gbpln2514.se 1418010155 gbpln2515.se 1424347006 gbpln2516.se 1345338187 gbpln2517.se 1057634659 gbpln2518.se 1462844728 gbpln2519.se 1499999691 gbpln252.seq 1434240655 gbpln2520.se 1466376772 gbpln2521.se 1458654292 gbpln2522.se 1486464873 gbpln2523.se 1419088503 gbpln2524.se 1414803952 gbpln2525.se 1173105642 gbpln2526.se 1328188372 gbpln2527.se 1485628212 gbpln2528.se 1254061309 gbpln2529.se 1499997699 gbpln253.seq 1411326247 gbpln2530.se 1491400819 gbpln2531.se 1462409885 gbpln2532.se 1467087613 gbpln2533.se 1445353268 gbpln2534.se 1473913312 gbpln2535.se 1458565398 gbpln2536.se 1253695064 gbpln2537.se 1275517046 gbpln2538.se 1202470949 gbpln2539.se 1499999378 gbpln254.seq 1258697653 gbpln2540.se 1438353575 gbpln2541.se 1439229830 gbpln2542.se 1362229617 gbpln2543.se 1397925246 gbpln2544.se 1497936136 gbpln2545.se 1499407062 gbpln2546.se 1492850539 gbpln2547.se 1471895020 gbpln2548.se 820380791 gbpln2549.se 1499996477 gbpln255.seq 753305075 gbpln2550.se 882902876 gbpln2551.se 636457809 gbpln2552.se 1021367343 gbpln2553.se 1027431723 gbpln2554.se 849351232 gbpln2555.se 961283480 gbpln2556.se 1076169475 gbpln2557.se 800489813 gbpln2558.se 971463919 gbpln2559.se 1499682554 gbpln256.seq 875748759 gbpln2560.se 664230418 gbpln2561.se 917057769 gbpln2562.se 939034723 gbpln2563.se 731830817 gbpln2564.se 791564584 gbpln2565.se 922438504 gbpln2566.se 634692215 gbpln2567.se 943117654 gbpln2568.se 938115435 gbpln2569.se 1435785989 gbpln257.seq 1490933062 gbpln2570.se 1496879177 gbpln2571.se 1481719918 gbpln2572.se 1478308122 gbpln2573.se 1433928615 gbpln2574.se 1496565041 gbpln2575.se 1441603757 gbpln2576.se 1491065433 gbpln2577.se 1166275976 gbpln2578.se 749697575 gbpln2579.se 1499837559 gbpln258.seq 850310026 gbpln2580.se 1010662688 gbpln2581.se 1026938782 gbpln2582.se 958973523 gbpln2583.se 1062642817 gbpln2584.se 963228666 gbpln2585.se 879497831 gbpln2586.se 904165280 gbpln2587.se 936802077 gbpln2588.se 782862322 gbpln2589.se 894288907 gbpln259.seq 918993133 gbpln2590.se 942196288 gbpln2591.se 1497057572 gbpln2592.se 1497064270 gbpln2593.se 1460395765 gbpln2594.se 1468481396 gbpln2595.se 1311042214 gbpln2596.se 1476147253 gbpln2597.se 1208902808 gbpln2598.se 1334504576 gbpln2599.se 1408504664 gbpln26.seq 665291577 gbpln260.seq 1139229803 gbpln2600.se 1354801730 gbpln2601.se 1417972183 gbpln2602.se 1386690491 gbpln2603.se 1431412747 gbpln2604.se 1363023461 gbpln2605.se 1414046992 gbpln2606.se 1383771500 gbpln2607.se 1441526520 gbpln2608.se 1322826001 gbpln2609.se 860028189 gbpln261.seq 1325185433 gbpln2610.se 1353443237 gbpln2611.se 1400463114 gbpln2612.se 1374700450 gbpln2613.se 1498305244 gbpln2614.se 1478498508 gbpln2615.se 1478705883 gbpln2616.se 1481694191 gbpln2617.se 1487581145 gbpln2618.se 1495576051 gbpln2619.se 800605872 gbpln262.seq 1474692462 gbpln2620.se 1401229672 gbpln2621.se 1488209575 gbpln2622.se 1482226972 gbpln2623.se 1480600863 gbpln2624.se 1300684726 gbpln2625.se 1411146303 gbpln2626.se 1442986576 gbpln2627.se 1483075460 gbpln2628.se 1490051616 gbpln2629.se 794469115 gbpln263.seq 1360386002 gbpln2630.se 1464284621 gbpln2631.se 1455561297 gbpln2632.se 1432286854 gbpln2633.se 1267767651 gbpln2634.se 1395992031 gbpln2635.se 1457505413 gbpln2636.se 1355050033 gbpln2637.se 1423590352 gbpln2638.se 1485979715 gbpln2639.se 1492903391 gbpln264.seq 1496495757 gbpln2640.se 1441228761 gbpln2641.se 1394397081 gbpln2642.se 1468717943 gbpln2643.se 1423589868 gbpln2644.se 1471627328 gbpln2645.se 1422227983 gbpln2646.se 1476033493 gbpln2647.se 1498672938 gbpln2648.se 1222958883 gbpln2649.se 1017558444 gbpln265.seq 1301327539 gbpln2650.se 1386449214 gbpln2651.se 1448666613 gbpln2652.se 1455826633 gbpln2653.se 1473311851 gbpln2654.se 1469138875 gbpln2655.se 1335434241 gbpln2656.se 1358122429 gbpln2657.se 1499479638 gbpln2658.se 1479669568 gbpln2659.se 924325157 gbpln266.seq 1490610924 gbpln2660.se 1493168809 gbpln2661.se 1424668530 gbpln2662.se 1459587888 gbpln2663.se 860039893 gbpln2664.se 833176228 gbpln2665.se 794500032 gbpln2666.se 768887202 gbpln2667.se 1443786059 gbpln2668.se 1486419092 gbpln2669.se 1201978654 gbpln267.seq 1493061512 gbpln2670.se 1479543550 gbpln2671.se 1491805941 gbpln2672.se 1496791605 gbpln2673.se 1245719793 gbpln2674.se 1382244507 gbpln2675.se 1442829818 gbpln2676.se 1289077492 gbpln2677.se 1199662418 gbpln2678.se 1074345715 gbpln2679.se 1227268207 gbpln268.seq 1486501220 gbpln2680.se 1277182309 gbpln2681.se 982379426 gbpln2682.se 1281330439 gbpln2683.se 1431440883 gbpln2684.se 1233028426 gbpln2685.se 1170984874 gbpln2686.se 1195347717 gbpln2687.se 1431440140 gbpln2688.se 1427266063 gbpln2689.se 1152253241 gbpln269.seq 1212915022 gbpln2690.se 1251009637 gbpln2691.se 1395191829 gbpln2692.se 1401502396 gbpln2693.se 1491839421 gbpln2694.se 1472519588 gbpln2695.se 1495658234 gbpln2696.se 1496443676 gbpln2697.se 1488217012 gbpln2698.se 1318150615 gbpln2699.se 1427497014 gbpln27.seq 1115248374 gbpln270.seq 1380386983 gbpln2700.se 1415325209 gbpln2701.se 1403501699 gbpln2702.se 1434323508 gbpln2703.se 1421338539 gbpln2704.se 1473262528 gbpln2705.se 1453411150 gbpln2706.se 1416432973 gbpln2707.se 1488724657 gbpln2708.se 1479045674 gbpln2709.se 1125506105 gbpln271.seq 1459674941 gbpln2710.se 1460004518 gbpln2711.se 1318168909 gbpln2712.se 1083273345 gbpln2713.se 1038940311 gbpln2714.se 1020234377 gbpln2715.se 977529630 gbpln2716.se 965294916 gbpln2717.se 951488026 gbpln2718.se 950474753 gbpln2719.se 1145303472 gbpln272.seq 942734911 gbpln2720.se 929806639 gbpln2721.se 921846459 gbpln2722.se 894765574 gbpln2723.se 883443104 gbpln2724.se 832342901 gbpln2725.se 826268823 gbpln2726.se 815836967 gbpln2727.se 793611001 gbpln2728.se 1496662034 gbpln2729.se 1497252511 gbpln273.seq 1328373183 gbpln2730.se 1495942541 gbpln2731.se 1462430583 gbpln2732.se 1462057761 gbpln2733.se 1421205591 gbpln2734.se 1456510636 gbpln2735.se 1355306362 gbpln2736.se 1251637603 gbpln2737.se 1262338753 gbpln2738.se 1238130086 gbpln2739.se 987259422 gbpln274.seq 1462387174 gbpln2740.se 1476550267 gbpln2741.se 1412216926 gbpln2742.se 1441264049 gbpln2743.se 1474271992 gbpln2744.se 1412654952 gbpln2745.se 1421936670 gbpln2746.se 1439494510 gbpln2747.se 1451424077 gbpln2748.se 1402325977 gbpln2749.se 689933987 gbpln275.seq 1447210332 gbpln2750.se 1425419792 gbpln2751.se 1443944210 gbpln2752.se 1497490629 gbpln2753.se 1446113228 gbpln2754.se 1490461941 gbpln2755.se 1400845806 gbpln2756.se 1429434517 gbpln2757.se 1413264559 gbpln2758.se 1384887821 gbpln2759.se 887561680 gbpln276.seq 1438871479 gbpln2760.se 1409854497 gbpln2761.se 1435234776 gbpln2762.se 1472482187 gbpln2763.se 1429212193 gbpln2764.se 1429063498 gbpln2765.se 1431757381 gbpln2766.se 1479279423 gbpln2767.se 1387444659 gbpln2768.se 1425903130 gbpln2769.se 834970472 gbpln277.seq 1439284037 gbpln2770.se 1426789117 gbpln2771.se 1434962678 gbpln2772.se 1417622992 gbpln2773.se 1429697874 gbpln2774.se 1448144286 gbpln2775.se 1417705174 gbpln2776.se 1466151143 gbpln2777.se 1434505420 gbpln2778.se 1416511704 gbpln2779.se 826391913 gbpln278.seq 1416294629 gbpln2780.se 1488735146 gbpln2781.se 1425595720 gbpln2782.se 1440852062 gbpln2783.se 1410490865 gbpln2784.se 1415332179 gbpln2785.se 1480691743 gbpln2786.se 1146451497 gbpln2787.se 1188560588 gbpln2788.se 1477675943 gbpln2789.se 792513917 gbpln279.seq 1484676893 gbpln2790.se 1454227859 gbpln2791.se 1490787074 gbpln2792.se 1404176888 gbpln2793.se 1473915786 gbpln2794.se 1473118233 gbpln2795.se 1382663491 gbpln2796.se 1244739185 gbpln2797.se 1078198819 gbpln2798.se 1466416136 gbpln2799.se 1492834195 gbpln28.seq 743209872 gbpln280.seq 1487374075 gbpln2800.se 1481677046 gbpln2801.se 1472570665 gbpln2802.se 1473399987 gbpln2803.se 1489490129 gbpln2804.se 1457993530 gbpln2805.se 1495919574 gbpln2806.se 1488908982 gbpln2807.se 1373711312 gbpln2808.se 1411864096 gbpln2809.se 1498927764 gbpln281.seq 1486403747 gbpln2810.se 1483790770 gbpln2811.se 1447652226 gbpln2812.se 1491677796 gbpln2813.se 1018597644 gbpln2814.se 1075516719 gbpln2815.se 1047637493 gbpln2816.se 1030836829 gbpln2817.se 1425387048 gbpln2818.se 1494929922 gbpln2819.se 860028189 gbpln282.seq 1474325092 gbpln2820.se 1446998858 gbpln2821.se 1474919714 gbpln2822.se 1491294184 gbpln2823.se 1482807671 gbpln2824.se 1469185867 gbpln2825.se 1480023591 gbpln2826.se 1361398352 gbpln2827.se 1403610535 gbpln2828.se 1418988833 gbpln2829.se 800605872 gbpln283.seq 1491535997 gbpln2830.se 1457029983 gbpln2831.se 1490391696 gbpln2832.se 1434637370 gbpln2833.se 1494986239 gbpln2834.se 1450984902 gbpln2835.se 1491218745 gbpln2836.se 1254204368 gbpln2837.se 1204067979 gbpln2838.se 1493626161 gbpln2839.se 794469115 gbpln284.seq 1458439491 gbpln2840.se 1456650086 gbpln2841.se 1488878049 gbpln2842.se 1450941476 gbpln2843.se 1491596291 gbpln2844.se 1476605219 gbpln2845.se 1498634797 gbpln2846.se 1498573994 gbpln2847.se 1484904177 gbpln2848.se 1487694842 gbpln2849.se 1492903391 gbpln285.seq 1480871491 gbpln2850.se 1485578029 gbpln2851.se 1494558491 gbpln2852.se 1465887426 gbpln2853.se 1462621360 gbpln2854.se 1331166032 gbpln2855.se 1338445020 gbpln2856.se 1457780733 gbpln2857.se 1484487478 gbpln2858.se 226438199 gbpln2859.se 997390294 gbpln286.seq 1429719138 gbpln2860.se 1293735134 gbpln2861.se 1157397834 gbpln2862.se 1030626970 gbpln2863.se 1005828119 gbpln2864.se 828859914 gbpln2865.se 1382709962 gbpln2866.se 1395472789 gbpln2867.se 1472554896 gbpln2868.se 801194736 gbpln2869.se 663098252 gbpln287.seq 892926392 gbpln2870.se 619187398 gbpln2871.se 996753292 gbpln2872.se 998473742 gbpln2873.se 832204346 gbpln2874.se 955744374 gbpln2875.se 1061675956 gbpln2876.se 777805699 gbpln2877.se 943926414 gbpln2878.se 866698384 gbpln2879.se 855592604 gbpln288.seq 671443890 gbpln2880.se 892730375 gbpln2881.se 911721841 gbpln2882.se 1488842871 gbpln2883.se 892248364 gbpln2884.se 638130712 gbpln2885.se 946376526 gbpln2886.se 948419438 gbpln2887.se 1437419407 gbpln2888.se 1475488249 gbpln2889.se 807031053 gbpln289.seq 1495463622 gbpln2890.se 1421294042 gbpln2891.se 1241989263 gbpln2892.se 1448812600 gbpln2893.se 1464616940 gbpln2894.se 1495193990 gbpln2895.se 693911022 gbpln2896.se 1296523906 gbpln2897.se 1295940497 gbpln2898.se 1000807886 gbpln2899.se 1466958135 gbpln29.seq 793905039 gbpln290.seq 987060023 gbpln2900.se 950017466 gbpln2901.se 898991805 gbpln2902.se 879509680 gbpln2903.se 857987831 gbpln2904.se 853225935 gbpln2905.se 761570205 gbpln2906.se 1495497058 gbpln2907.se 1440464464 gbpln2908.se 1421551486 gbpln2909.se 1491456147 gbpln291.seq 1276721406 gbpln2910.se 1180740568 gbpln2911.se 1111650979 gbpln2912.se 1482796340 gbpln2913.se 1397850176 gbpln2914.se 1396888570 gbpln2915.se 1337035954 gbpln2916.se 1394477837 gbpln2917.se 1155245401 gbpln2918.se 1423029563 gbpln2919.se 1466632070 gbpln292.seq 1241113394 gbpln2920.se 1492290716 gbpln2921.se 1453246274 gbpln2922.se 1461023460 gbpln2923.se 1344837166 gbpln2924.se 1369055704 gbpln2925.se 1048628373 gbpln2926.se 1339693110 gbpln2927.se 1329723160 gbpln2928.se 1137492133 gbpln2929.se 840180304 gbpln293.seq 1169292709 gbpln2930.se 1162037896 gbpln2931.se 1399143544 gbpln2932.se 1049310081 gbpln2933.se 1479972649 gbpln2934.se 1229168061 gbpln2935.se 1429988372 gbpln2936.se 1471129055 gbpln2937.se 1358324041 gbpln2938.se 1487133376 gbpln2939.se 796430245 gbpln294.seq 1477779283 gbpln2940.se 1471116521 gbpln2941.se 1496724761 gbpln2942.se 1487954024 gbpln2943.se 1427995911 gbpln2944.se 937296468 gbpln2945.se 749288384 gbpln2946.se 900363358 gbpln2947.se 1003612466 gbpln2948.se 1043665591 gbpln2949.se 779180715 gbpln295.seq 963101835 gbpln2950.se 1082640752 gbpln2951.se 964013225 gbpln2952.se 887784510 gbpln2953.se 907274270 gbpln2954.se 930759000 gbpln2955.se 791994002 gbpln2956.se 911577343 gbpln2957.se 942835202 gbpln2958.se 1475596620 gbpln2959.se 1486604510 gbpln296.seq 1245524418 gbpln2960.se 628375663 gbpln2961.se 888271304 gbpln2962.se 787967387 gbpln2963.se 1441630965 gbpln2964.se 1479063891 gbpln2965.se 1477219690 gbpln2966.se 1472573999 gbpln2967.se 1474893613 gbpln2968.se 1473542501 gbpln2969.se 1445385427 gbpln297.seq 1475999450 gbpln2970.se 1469855209 gbpln2971.se 1394960939 gbpln2972.se 1444489502 gbpln2973.se 1416928718 gbpln2974.se 1490501021 gbpln2975.se 665559588 gbpln2976.se 1336227702 gbpln2977.se 1256724679 gbpln2978.se 1247104743 gbpln2979.se 831209396 gbpln298.seq 1225403881 gbpln2980.se 1209633308 gbpln2981.se 1176439839 gbpln2982.se 1051904233 gbpln2983.se 1018465102 gbpln2984.se 993106384 gbpln2985.se 933960075 gbpln2986.se 1459486481 gbpln2987.se 1464965594 gbpln2988.se 1466100849 gbpln2989.se 783682955 gbpln299.seq 1438173350 gbpln2990.se 1443271486 gbpln2991.se 850502995 gbpln2992.se 1310783221 gbpln2993.se 1240148104 gbpln2994.se 1214381838 gbpln2995.se 1174222526 gbpln2996.se 1195681445 gbpln2997.se 1144570066 gbpln2998.se 1005996113 gbpln2999.se 1499999805 gbpln3.seq 1292001848 gbpln30.seq 775938782 gbpln300.seq 1005905113 gbpln3000.se 974817940 gbpln3001.se 892964985 gbpln3002.se 1492287528 gbpln3003.se 1489392200 gbpln3004.se 1471231679 gbpln3005.se 1486731612 gbpln3006.se 1076919015 gbpln3007.se 1303382863 gbpln3008.se 1227266561 gbpln3009.se 1442399440 gbpln301.seq 1499954057 gbpln3010.se 1499855899 gbpln3011.se 1499995721 gbpln3012.se 1499933362 gbpln3013.se 1499528438 gbpln3014.se 478294904 gbpln3015.se 1471877377 gbpln302.seq 872662143 gbpln303.seq 815663229 gbpln304.seq 813528167 gbpln305.seq 780491844 gbpln306.seq 734904793 gbpln307.seq 1451981137 gbpln308.seq 824184474 gbpln309.seq 1498887865 gbpln31.seq 768070182 gbpln310.seq 1491145948 gbpln311.seq 1472604409 gbpln312.seq 1481497172 gbpln313.seq 783385752 gbpln314.seq 770520351 gbpln315.seq 1452863252 gbpln316.seq 1486785182 gbpln317.seq 906907390 gbpln318.seq 844110716 gbpln319.seq 1498907226 gbpln32.seq 841780855 gbpln320.seq 805270043 gbpln321.seq 764396863 gbpln322.seq 841492595 gbpln323.seq 714482811 gbpln324.seq 916127997 gbpln325.seq 858459407 gbpln326.seq 848936990 gbpln327.seq 813129213 gbpln328.seq 765593150 gbpln329.seq 1406601771 gbpln33.seq 862731158 gbpln330.seq 665885634 gbpln331.seq 854365265 gbpln332.seq 802776346 gbpln333.seq 793295912 gbpln334.seq 1480158894 gbpln335.seq 1429544600 gbpln336.seq 814320946 gbpln337.seq 759349720 gbpln338.seq 1487159826 gbpln339.seq 1500000125 gbpln34.seq 1463992028 gbpln340.seq 684180819 gbpln341.seq 873292213 gbpln342.seq 827422505 gbpln343.seq 815925825 gbpln344.seq 779009585 gbpln345.seq 739747654 gbpln346.seq 1498046242 gbpln347.seq 849628701 gbpln348.seq 803882830 gbpln349.seq 1499274671 gbpln35.seq 794420470 gbpln350.seq 1474790996 gbpln351.seq 1469965572 gbpln352.seq 854770002 gbpln353.seq 805931576 gbpln354.seq 798923954 gbpln355.seq 1489544894 gbpln356.seq 1467528130 gbpln357.seq 854339916 gbpln358.seq 803900400 gbpln359.seq 1498243402 gbpln36.seq 791449620 gbpln360.seq 1476207543 gbpln361.seq 1475343864 gbpln362.seq 870939392 gbpln363.seq 809408813 gbpln364.seq 801514137 gbpln365.seq 1492438448 gbpln366.seq 1476330312 gbpln367.seq 846934671 gbpln368.seq 794708793 gbpln369.seq 1472412878 gbpln37.seq 789781753 gbpln370.seq 1475691254 gbpln371.seq 1489470879 gbpln372.seq 888406351 gbpln373.seq 835271741 gbpln374.seq 823533989 gbpln375.seq 787819193 gbpln376.seq 748786657 gbpln377.seq 1483648875 gbpln378.seq 1197559843 gbpln379.seq 1495420808 gbpln38.seq 898446949 gbpln380.seq 628489896 gbpln381.seq 1024113089 gbpln382.seq 1032878661 gbpln383.seq 858694781 gbpln384.seq 960391204 gbpln385.seq 1090094606 gbpln386.seq 781959143 gbpln387.seq 946995961 gbpln388.seq 857542781 gbpln389.seq 1498182621 gbpln39.seq 656405285 gbpln390.seq 907889097 gbpln391.seq 896386890 gbpln392.seq 726432335 gbpln393.seq 798296822 gbpln394.seq 918393750 gbpln395.seq 584961784 gbpln396.seq 948865971 gbpln397.seq 954536271 gbpln398.seq 819735731 gbpln399.seq 1485799305 gbpln4.seq 1461060051 gbpln40.seq 756588093 gbpln400.seq 876067119 gbpln401.seq 625446321 gbpln402.seq 977801494 gbpln403.seq 854357980 gbpln404.seq 807732556 gbpln405.seq 947696453 gbpln406.seq 1067629605 gbpln407.seq 822222048 gbpln408.seq 950272996 gbpln409.seq 1492545830 gbpln41.seq 1488985571 gbpln410.seq 894745096 gbpln411.seq 893352134 gbpln412.seq 1498806035 gbpln413.seq 1491810166 gbpln414.seq 933986451 gbpln415.seq 939527664 gbpln416.seq 810117922 gbpln417.seq 765938558 gbpln418.seq 886537018 gbpln419.seq 1415277410 gbpln42.seq 623519964 gbpln420.seq 996940649 gbpln421.seq 1030190034 gbpln422.seq 832828033 gbpln423.seq 956342979 gbpln424.seq 1134286144 gbpln425.seq 790513299 gbpln426.seq 944161893 gbpln427.seq 860035788 gbpln428.seq 647268685 gbpln429.seq 1340752827 gbpln43.seq 902239623 gbpln430.seq 1345936752 gbpln431.seq 787834228 gbpln432.seq 910724363 gbpln433.seq 606016896 gbpln434.seq 961485234 gbpln435.seq 1242775191 gbpln436.seq 1453328788 gbpln437.seq 818591771 gbpln438.seq 766580884 gbpln439.seq 1497609858 gbpln44.seq 1476620557 gbpln440.seq 1460693671 gbpln441.seq 750738544 gbpln442.seq 1496665003 gbpln443.seq 995069022 gbpln444.seq 1012956234 gbpln445.seq 827074347 gbpln446.seq 940621783 gbpln447.seq 1079418810 gbpln448.seq 776922106 gbpln449.seq 1450262737 gbpln45.seq 938380968 gbpln450.seq 1492330319 gbpln451.seq 891714442 gbpln452.seq 878638403 gbpln453.seq 721632671 gbpln454.seq 779156122 gbpln455.seq 895553446 gbpln456.seq 604678568 gbpln457.seq 931006295 gbpln458.seq 933660027 gbpln459.seq 1495406067 gbpln46.seq 810459540 gbpln460.seq 761872100 gbpln461.seq 878702815 gbpln462.seq 627081460 gbpln463.seq 994320235 gbpln464.seq 999434327 gbpln465.seq 823789349 gbpln466.seq 945629782 gbpln467.seq 1062113821 gbpln468.seq 792298939 gbpln469.seq 1496868584 gbpln47.seq 941851700 gbpln470.seq 850142413 gbpln471.seq 656955691 gbpln472.seq 904094753 gbpln473.seq 900193903 gbpln474.seq 1470079206 gbpln475.seq 1497721340 gbpln476.seq 937117048 gbpln477.seq 936021119 gbpln478.seq 812696702 gbpln479.seq 1458769944 gbpln48.seq 746628212 gbpln480.seq 897168807 gbpln481.seq 626698501 gbpln482.seq 1007072101 gbpln483.seq 1000831797 gbpln484.seq 841918855 gbpln485.seq 963426816 gbpln486.seq 1093654114 gbpln487.seq 791118382 gbpln488.seq 959940756 gbpln489.seq 1496632063 gbpln49.seq 853263842 gbpln490.seq 648051398 gbpln491.seq 901282075 gbpln492.seq 923491092 gbpln493.seq 732477869 gbpln494.seq 789987733 gbpln495.seq 926022053 gbpln496.seq 610840579 gbpln497.seq 949759032 gbpln498.seq 955444559 gbpln499.seq 1441569501 gbpln5.seq 1497050455 gbpln50.seq 818480442 gbpln500.seq 752251380 gbpln501.seq 897893149 gbpln502.seq 631111272 gbpln503.seq 1022032953 gbpln504.seq 1006306956 gbpln505.seq 837035085 gbpln506.seq 966140819 gbpln507.seq 1090560006 gbpln508.seq 800164754 gbpln509.seq 1216818349 gbpln51.seq 959884028 gbpln510.seq 886916735 gbpln511.seq 641540050 gbpln512.seq 910168783 gbpln513.seq 908785549 gbpln514.seq 729527181 gbpln515.seq 797552105 gbpln516.seq 910975470 gbpln517.seq 616026199 gbpln518.seq 945685366 gbpln519.seq 1406513490 gbpln52.seq 953145956 gbpln520.seq 820081609 gbpln521.seq 763165947 gbpln522.seq 1489098826 gbpln523.seq 1009123187 gbpln524.seq 1016689515 gbpln525.seq 832912303 gbpln526.seq 952656374 gbpln527.seq 1065835283 gbpln528.seq 776075044 gbpln529.seq 1381482888 gbpln53.seq 935940025 gbpln530.seq 1488231655 gbpln531.seq 1487557825 gbpln532.seq 720169483 gbpln533.seq 780564861 gbpln534.seq 1499144496 gbpln535.seq 934713391 gbpln536.seq 1233388213 gbpln537.seq 807542511 gbpln538.seq 757881986 gbpln539.seq 1446757676 gbpln54.seq 889760627 gbpln540.seq 635890046 gbpln541.seq 1007873898 gbpln542.seq 1015524558 gbpln543.seq 836625022 gbpln544.seq 959076059 gbpln545.seq 1077416379 gbpln546.seq 789416089 gbpln547.seq 958430056 gbpln548.seq 877922843 gbpln549.seq 1499991276 gbpln55.seq 648665455 gbpln550.seq 907513209 gbpln551.seq 904978028 gbpln552.seq 727024880 gbpln553.seq 789120540 gbpln554.seq 898507915 gbpln555.seq 617229811 gbpln556.seq 942711764 gbpln557.seq 964780021 gbpln558.seq 818917331 gbpln559.seq 1472586014 gbpln56.seq 755294557 gbpln560.seq 882064051 gbpln561.seq 627203691 gbpln562.seq 993595919 gbpln563.seq 1021497440 gbpln564.seq 827286497 gbpln565.seq 962451301 gbpln566.seq 1082256067 gbpln567.seq 781463827 gbpln568.seq 919665368 gbpln569.seq 1398723248 gbpln57.seq 1497522046 gbpln570.seq 905574854 gbpln571.seq 906714977 gbpln572.seq 718743537 gbpln573.seq 787529633 gbpln574.seq 910251919 gbpln575.seq 608518276 gbpln576.seq 934541265 gbpln577.seq 954054955 gbpln578.seq 1442359182 gbpln579.seq 1412134403 gbpln58.seq 1009766480 gbpln580.seq 1318260463 gbpln581.seq 1253136609 gbpln582.seq 1066198175 gbpln583.seq 1119572655 gbpln584.seq 1040217505 gbpln585.seq 1310077288 gbpln586.seq 955690374 gbpln587.seq 1230684440 gbpln588.seq 1179787958 gbpln589.seq 1494813194 gbpln59.seq 1125383520 gbpln590.seq 1051194518 gbpln591.seq 965656648 gbpln592.seq 1363518097 gbpln593.seq 1497325995 gbpln594.seq 787261705 gbpln595.seq 773098599 gbpln596.seq 1456694585 gbpln597.seq 1200145527 gbpln598.seq 1449107426 gbpln599.seq 1472320582 gbpln6.seq 1499741358 gbpln60.seq 1445293748 gbpln600.seq 1219201533 gbpln601.seq 1281941476 gbpln602.seq 1485920982 gbpln603.seq 1322811522 gbpln604.seq 756143249 gbpln605.seq 878426054 gbpln606.seq 631056251 gbpln607.seq 993852367 gbpln608.seq 1020132695 gbpln609.seq 1469312219 gbpln61.seq 830166807 gbpln610.seq 955723315 gbpln611.seq 1057964328 gbpln612.seq 784007552 gbpln613.seq 947940191 gbpln614.seq 857511193 gbpln615.seq 649137171 gbpln616.seq 903393879 gbpln617.seq 908180396 gbpln618.seq 721135945 gbpln619.seq 1498613978 gbpln62.seq 786739709 gbpln620.seq 918070756 gbpln621.seq 603192844 gbpln622.seq 938102555 gbpln623.seq 955978436 gbpln624.seq 1498129368 gbpln625.seq 1395905812 gbpln626.seq 768159651 gbpln627.seq 891261263 gbpln628.seq 1017239134 gbpln629.seq 1498626165 gbpln63.seq 1036737053 gbpln630.seq 980587319 gbpln631.seq 1096962209 gbpln632.seq 964715275 gbpln633.seq 883795567 gbpln634.seq 879409471 gbpln635.seq 922242639 gbpln636.seq 805484043 gbpln637.seq 912391541 gbpln638.seq 954577618 gbpln639.seq 1490947978 gbpln64.seq 1499999920 gbpln640.seq 1499982198 gbpln641.seq 1499998834 gbpln642.seq 1499999780 gbpln643.seq 1499998415 gbpln644.seq 1499998963 gbpln645.seq 1500000114 gbpln646.seq 1499997921 gbpln647.seq 1499999199 gbpln648.seq 1499999812 gbpln649.seq 1483517028 gbpln65.seq 1499811275 gbpln650.seq 1499922730 gbpln651.seq 1499945639 gbpln652.seq 1499999666 gbpln653.seq 832939980 gbpln654.seq 674055631 gbpln655.seq 865045961 gbpln656.seq 815791689 gbpln657.seq 802718902 gbpln658.seq 1497835829 gbpln659.seq 1499268733 gbpln66.seq 1489200818 gbpln660.seq 873797632 gbpln661.seq 820367220 gbpln662.seq 806296382 gbpln663.seq 775209384 gbpln664.seq 744231520 gbpln665.seq 817156402 gbpln666.seq 771380170 gbpln667.seq 913253142 gbpln668.seq 634934982 gbpln669.seq 1492691113 gbpln67.seq 1019175188 gbpln670.seq 1023638564 gbpln671.seq 822225605 gbpln672.seq 961290952 gbpln673.seq 1090804562 gbpln674.seq 813694518 gbpln675.seq 962545328 gbpln676.seq 873725319 gbpln677.seq 673190932 gbpln678.seq 905064826 gbpln679.seq 1474823203 gbpln68.seq 908590682 gbpln680.seq 742712720 gbpln681.seq 793279946 gbpln682.seq 934932909 gbpln683.seq 640700840 gbpln684.seq 961568346 gbpln685.seq 952066709 gbpln686.seq 1470907411 gbpln687.seq 1315696090 gbpln688.seq 1451561486 gbpln689.seq 1468140126 gbpln69.seq 1409767917 gbpln690.seq 1192999645 gbpln691.seq 1105379400 gbpln692.seq 1196658436 gbpln693.seq 1136119548 gbpln694.seq 1296877006 gbpln695.seq 1251013715 gbpln696.seq 1321801983 gbpln697.seq 1445650123 gbpln698.seq 761389338 gbpln699.seq 1486765693 gbpln7.seq 1499125746 gbpln70.seq 810823695 gbpln700.seq 945017875 gbpln701.seq 820289825 gbpln702.seq 819330824 gbpln703.seq 1386616317 gbpln704.seq 1365708889 gbpln705.seq 1283325611 gbpln706.seq 1090613324 gbpln707.seq 1284507799 gbpln708.seq 1122567296 gbpln709.seq 1458737625 gbpln71.seq 1192074506 gbpln710.seq 1181896740 gbpln711.seq 1430814492 gbpln712.seq 858786663 gbpln713.seq 1482575758 gbpln714.seq 1256005171 gbpln715.seq 1249214474 gbpln716.seq 1164522681 gbpln717.seq 1002097666 gbpln718.seq 1300955592 gbpln719.seq 1415659241 gbpln72.seq 1317957634 gbpln720.seq 1148040939 gbpln721.seq 1403417765 gbpln722.seq 1375754075 gbpln723.seq 1327873437 gbpln724.seq 1281078332 gbpln725.seq 1383451324 gbpln726.seq 1300107704 gbpln727.seq 1290738490 gbpln728.seq 1459920096 gbpln729.seq 1454879251 gbpln73.seq 1006352199 gbpln730.seq 962815279 gbpln731.seq 975138624 gbpln732.seq 906550423 gbpln733.seq 790269619 gbpln734.seq 956926034 gbpln735.seq 908369814 gbpln736.seq 1035806383 gbpln737.seq 1095241384 gbpln738.seq 889046375 gbpln739.seq 1419709152 gbpln74.seq 920177986 gbpln740.seq 934896187 gbpln741.seq 972756494 gbpln742.seq 1478454737 gbpln743.seq 1479400215 gbpln744.seq 1382640922 gbpln745.seq 1372701817 gbpln746.seq 1490030230 gbpln747.seq 1296249908 gbpln748.seq 1454591689 gbpln749.seq 1299937998 gbpln75.seq 1470492475 gbpln750.seq 1449617605 gbpln751.seq 1223515912 gbpln752.seq 1372955396 gbpln753.seq 1437909873 gbpln754.seq 1307026425 gbpln755.seq 1462620087 gbpln756.seq 1466603356 gbpln757.seq 1073064191 gbpln758.seq 890586335 gbpln759.seq 1328436936 gbpln76.seq 628166165 gbpln760.seq 1008494769 gbpln761.seq 987228439 gbpln762.seq 843057145 gbpln763.seq 959088226 gbpln764.seq 1080118899 gbpln765.seq 790032688 gbpln766.seq 943744807 gbpln767.seq 858758922 gbpln768.seq 664109823 gbpln769.seq 1464201621 gbpln77.seq 920678547 gbpln770.seq 888501596 gbpln771.seq 739915903 gbpln772.seq 788736235 gbpln773.seq 944601114 gbpln774.seq 621465898 gbpln775.seq 948555730 gbpln776.seq 954911742 gbpln777.seq 854896726 gbpln778.seq 752395251 gbpln779.seq 1485220550 gbpln78.seq 890282441 gbpln780.seq 626588937 gbpln781.seq 1004358313 gbpln782.seq 1028945402 gbpln783.seq 838465030 gbpln784.seq 950517847 gbpln785.seq 1082441570 gbpln786.seq 789583361 gbpln787.seq 950035125 gbpln788.seq 853507173 gbpln789.seq 1494892490 gbpln79.seq 659807142 gbpln790.seq 902654821 gbpln791.seq 890952839 gbpln792.seq 721824594 gbpln793.seq 785634142 gbpln794.seq 909002040 gbpln795.seq 625532225 gbpln796.seq 945667284 gbpln797.seq 953425672 gbpln798.seq 871480959 gbpln799.seq 1422472053 gbpln8.seq 1371122534 gbpln80.seq 1254084023 gbpln800.seq 1125916060 gbpln801.seq 1182821230 gbpln802.seq 1211366567 gbpln803.seq 746226477 gbpln804.seq 808684469 gbpln805.seq 907082918 gbpln806.seq 776688264 gbpln807.seq 1492098096 gbpln808.seq 1287386861 gbpln809.seq 1494222303 gbpln81.seq 1186027473 gbpln810.seq 1009876518 gbpln811.seq 1484585726 gbpln812.seq 1144770105 gbpln813.seq 752395251 gbpln814.seq 890282441 gbpln815.seq 626588937 gbpln816.seq 1004358313 gbpln817.seq 1028945402 gbpln818.seq 838465030 gbpln819.seq 1439085729 gbpln82.seq 950517847 gbpln820.seq 1082441570 gbpln821.seq 789583361 gbpln822.seq 950035125 gbpln823.seq 853507173 gbpln824.seq 659807142 gbpln825.seq 902654821 gbpln826.seq 890952839 gbpln827.seq 721824594 gbpln828.seq 785634142 gbpln829.seq 1429889919 gbpln83.seq 909002040 gbpln830.seq 625532225 gbpln831.seq 945667284 gbpln832.seq 953425672 gbpln833.seq 1496390997 gbpln834.seq 660302163 gbpln835.seq 841140962 gbpln836.seq 1479991498 gbpln837.seq 1471774772 gbpln838.seq 1471086893 gbpln839.seq 1405317085 gbpln84.seq 1484902160 gbpln840.seq 1468998773 gbpln841.seq 1490807609 gbpln842.seq 1479849438 gbpln843.seq 1498136456 gbpln844.seq 1470643875 gbpln845.seq 1445523370 gbpln846.seq 1467112606 gbpln847.seq 1473756857 gbpln848.seq 1466744422 gbpln849.seq 1341413688 gbpln85.seq 1445506294 gbpln850.seq 1405467369 gbpln851.seq 1440178564 gbpln852.seq 1419442824 gbpln853.seq 1178669529 gbpln854.seq 1224386957 gbpln855.seq 1217565232 gbpln856.seq 1215182135 gbpln857.seq 1193065665 gbpln858.seq 1256868481 gbpln859.seq 1264034698 gbpln86.seq 1217181199 gbpln860.seq 1374525226 gbpln861.seq 1176201884 gbpln862.seq 1216512337 gbpln863.seq 1281327782 gbpln864.seq 1167507852 gbpln865.seq 1237355990 gbpln866.seq 1197174379 gbpln867.seq 1324050362 gbpln868.seq 1450789177 gbpln869.seq 1236764828 gbpln87.seq 1260361994 gbpln870.seq 1204102838 gbpln871.seq 1480875055 gbpln872.seq 716975954 gbpln873.seq 888116044 gbpln874.seq 1464078034 gbpln875.seq 1378600950 gbpln876.seq 1230029992 gbpln877.seq 1331088471 gbpln878.seq 1200830607 gbpln879.seq 1491215859 gbpln88.seq 1307198823 gbpln880.seq 1133282366 gbpln881.seq 1212126107 gbpln882.seq 1131270577 gbpln883.seq 749094537 gbpln884.seq 814254329 gbpln885.seq 912544337 gbpln886.seq 784096665 gbpln887.seq 1481092451 gbpln888.seq 1299467738 gbpln889.seq 1459648960 gbpln89.seq 1170366333 gbpln890.seq 1022731835 gbpln891.seq 1308956706 gbpln892.seq 1124459634 gbpln893.seq 1266075131 gbpln894.seq 1076006545 gbpln895.seq 1319697273 gbpln896.seq 806193452 gbpln897.seq 904824619 gbpln898.seq 776420566 gbpln899.seq 1201022408 gbpln9.seq 1262658372 gbpln90.seq 1492527279 gbpln900.seq 1275668669 gbpln901.seq 1097153240 gbpln902.seq 984429897 gbpln903.seq 1016771778 gbpln904.seq 1128314147 gbpln905.seq 1245113516 gbpln906.seq 1159055196 gbpln907.seq 895546793 gbpln908.seq 732992509 gbpln909.seq 1488086519 gbpln91.seq 798139251 gbpln910.seq 921791411 gbpln911.seq 777495740 gbpln912.seq 1494182531 gbpln913.seq 1279159076 gbpln914.seq 1162567100 gbpln915.seq 1000863545 gbpln916.seq 1307492273 gbpln917.seq 1133043144 gbpln918.seq 1248802672 gbpln919.seq 1407723759 gbpln92.seq 1173666621 gbpln920.seq 1346583215 gbpln921.seq 807446381 gbpln922.seq 917394369 gbpln923.seq 777668408 gbpln924.seq 1483200298 gbpln925.seq 1259032815 gbpln926.seq 1115161328 gbpln927.seq 989567816 gbpln928.seq 1154259307 gbpln929.seq 1494162414 gbpln93.seq 1101835085 gbpln930.seq 1262420145 gbpln931.seq 1094720907 gbpln932.seq 1480954316 gbpln933.seq 820138713 gbpln934.seq 895203128 gbpln935.seq 777847907 gbpln936.seq 804875802 gbpln937.seq 1291079079 gbpln938.seq 1213580564 gbpln939.seq 1499473543 gbpln94.seq 1133477596 gbpln940.seq 1014898533 gbpln941.seq 1288500742 gbpln942.seq 1170815820 gbpln943.seq 1187918773 gbpln944.seq 1208700439 gbpln945.seq 745824416 gbpln946.seq 817297680 gbpln947.seq 923586945 gbpln948.seq 780016878 gbpln949.seq 1487837254 gbpln95.seq 1497792718 gbpln950.seq 1286399654 gbpln951.seq 1143042188 gbpln952.seq 1011099532 gbpln953.seq 1325839737 gbpln954.seq 1129969374 gbpln955.seq 1272509531 gbpln956.seq 1195891009 gbpln957.seq 1333198244 gbpln958.seq 819077704 gbpln959.seq 1486652589 gbpln96.seq 891997984 gbpln960.seq 777492908 gbpln961.seq 1498914668 gbpln962.seq 1270569795 gbpln963.seq 1130843274 gbpln964.seq 1007358830 gbpln965.seq 1326760426 gbpln966.seq 1154071549 gbpln967.seq 1250256749 gbpln968.seq 1109197953 gbpln969.seq 1497919667 gbpln97.seq 1301309890 gbpln970.seq 812468635 gbpln971.seq 919757374 gbpln972.seq 777552475 gbpln973.seq 1489149205 gbpln974.seq 1258426749 gbpln975.seq 1094730642 gbpln976.seq 998344081 gbpln977.seq 1319533109 gbpln978.seq 1148368580 gbpln979.seq 1405100855 gbpln98.seq 1257529825 gbpln980.seq 1175057311 gbpln981.seq 1305623792 gbpln982.seq 816136640 gbpln983.seq 924803370 gbpln984.seq 776794397 gbpln985.seq 808394510 gbpln986.seq 1303551846 gbpln987.seq 1276385388 gbpln988.seq 1162956927 gbpln989.seq 1493640099 gbpln99.seq 974246336 gbpln990.seq 1283612090 gbpln991.seq 1161229889 gbpln992.seq 1186729118 gbpln993.seq 1104666499 gbpln994.seq 723542068 gbpln995.seq 804482449 gbpln996.seq 912258274 gbpln997.seq 773093595 gbpln998.seq 1489550620 gbpln999.seq 1499989263 gbpri1.seq 1394043154 gbpri10.seq 1308233895 gbpri11.seq 1352591724 gbpri12.seq 1495555692 gbpri13.seq 1402237462 gbpri14.seq 1487902997 gbpri15.seq 1347857626 gbpri16.seq 1491380503 gbpri17.seq 1397668511 gbpri18.seq 1369669675 gbpri19.seq 1499865965 gbpri2.seq 1439722150 gbpri20.seq 1499999610 gbpri21.seq 1499993821 gbpri22.seq 1447376609 gbpri23.seq 1493653611 gbpri24.seq 1490880739 gbpri25.seq 1493262066 gbpri26.seq 1499901391 gbpri27.seq 494149383 gbpri28.seq 1499835984 gbpri3.seq 1499966483 gbpri4.seq 1499767048 gbpri5.seq 1372350935 gbpri6.seq 1440746568 gbpri7.seq 1473652046 gbpri8.seq 1441991909 gbpri9.seq 0 gbrel.txt 1499870774 gbrod1.seq 1418785115 gbrod10.seq 1461787632 gbrod100.seq 1303813219 gbrod101.seq 1443709248 gbrod102.seq 1487930170 gbrod103.seq 1352000298 gbrod104.seq 1497255342 gbrod105.seq 1215970167 gbrod106.seq 1323685781 gbrod107.seq 1425029285 gbrod108.seq 1436426304 gbrod109.seq 1478819696 gbrod11.seq 1498137432 gbrod110.seq 1384334707 gbrod111.seq 1497989819 gbrod112.seq 1369807944 gbrod113.seq 1375688364 gbrod114.seq 1183132641 gbrod115.seq 1212798272 gbrod116.seq 1328613700 gbrod117.seq 1476780417 gbrod118.seq 1499301509 gbrod119.seq 1404514224 gbrod12.seq 1366941914 gbrod120.seq 1495005819 gbrod121.seq 1269316912 gbrod122.seq 1399033184 gbrod123.seq 1430504650 gbrod124.seq 1195193971 gbrod125.seq 1362763615 gbrod126.seq 1134198619 gbrod127.seq 1443643135 gbrod13.seq 1356809286 gbrod14.seq 1408103836 gbrod15.seq 1493185268 gbrod16.seq 1477393715 gbrod17.seq 1445384384 gbrod18.seq 1498878132 gbrod19.seq 1499967437 gbrod2.seq 1242639125 gbrod20.seq 1488603546 gbrod21.seq 1239262283 gbrod22.seq 1351547492 gbrod23.seq 1434496523 gbrod24.seq 1387638765 gbrod25.seq 1486251329 gbrod26.seq 1347390436 gbrod27.seq 1452122190 gbrod28.seq 1353193118 gbrod29.seq 1499850426 gbrod3.seq 1370231234 gbrod30.seq 1370743208 gbrod31.seq 1453193685 gbrod32.seq 1484525776 gbrod33.seq 1406105502 gbrod34.seq 1474692538 gbrod35.seq 1404292919 gbrod36.seq 1358612176 gbrod37.seq 1325901204 gbrod38.seq 1445832321 gbrod39.seq 1499996682 gbrod4.seq 1301809704 gbrod40.seq 1459759409 gbrod41.seq 1371820929 gbrod42.seq 1379541974 gbrod43.seq 1447951148 gbrod44.seq 1358076947 gbrod45.seq 1393051649 gbrod46.seq 1377941029 gbrod47.seq 1484184886 gbrod48.seq 1439114050 gbrod49.seq 1497393506 gbrod5.seq 1409951130 gbrod50.seq 1472027087 gbrod51.seq 1372610888 gbrod52.seq 1482622482 gbrod53.seq 1393105943 gbrod54.seq 1451159866 gbrod55.seq 1434520361 gbrod56.seq 1444092726 gbrod57.seq 1361891899 gbrod58.seq 1453486986 gbrod59.seq 1499972379 gbrod6.seq 1458676727 gbrod60.seq 1379094101 gbrod61.seq 1475060334 gbrod62.seq 1359296239 gbrod63.seq 1465899229 gbrod64.seq 1295906456 gbrod65.seq 1477278364 gbrod66.seq 1378018089 gbrod67.seq 1390451722 gbrod68.seq 1462626302 gbrod69.seq 1366739659 gbrod7.seq 1299128117 gbrod70.seq 1371052535 gbrod71.seq 1444445568 gbrod72.seq 1478048412 gbrod73.seq 1480151384 gbrod74.seq 1426832728 gbrod75.seq 1455522110 gbrod76.seq 1332398568 gbrod77.seq 1471786581 gbrod78.seq 1376661169 gbrod79.seq 1334673612 gbrod8.seq 1454859611 gbrod80.seq 1295571253 gbrod81.seq 1399344953 gbrod82.seq 1315896821 gbrod83.seq 1411009597 gbrod84.seq 1453282390 gbrod85.seq 1391252549 gbrod86.seq 1498811032 gbrod87.seq 1444865055 gbrod88.seq 1488474687 gbrod89.seq 1458358985 gbrod9.seq 1331476829 gbrod90.seq 1465473324 gbrod91.seq 1416734769 gbrod92.seq 1486479413 gbrod93.seq 1462152570 gbrod94.seq 1423079792 gbrod95.seq 1368356742 gbrod96.seq 1452029512 gbrod97.seq 1391575059 gbrod98.seq 1477641360 gbrod99.seq 1499997851 gbsts1.seq 1499998186 gbsts2.seq 1449999556 gbsts3.seq 1434557958 gbsyn1.seq 197750260 gbsyn10.seq 1317756404 gbsyn2.seq 1363478773 gbsyn3.seq 1429349564 gbsyn4.seq 1317756374 gbsyn5.seq 1363478755 gbsyn6.seq 1499793795 gbsyn7.seq 1499961094 gbsyn8.seq 1499998789 gbsyn9.seq 1499998290 gbtsa1.seq 1499998598 gbtsa10.seq 1499998053 gbtsa11.seq 1499999603 gbtsa12.seq 1499998495 gbtsa13.seq 1499999668 gbtsa14.seq 1499996779 gbtsa15.seq 1499999390 gbtsa16.seq 1499998148 gbtsa17.seq 1499999490 gbtsa18.seq 1499998143 gbtsa19.seq 1499997019 gbtsa2.seq 1499997158 gbtsa20.seq 1499999511 gbtsa21.seq 1499997266 gbtsa22.seq 1499998781 gbtsa23.seq 1499995672 gbtsa24.seq 1499999003 gbtsa25.seq 1499997805 gbtsa26.seq 1499995413 gbtsa27.seq 1499996265 gbtsa28.seq 1499996472 gbtsa29.seq 1499999960 gbtsa3.seq 1500000044 gbtsa30.seq 1499999468 gbtsa31.seq 1499997036 gbtsa32.seq 1499993936 gbtsa33.seq 1499996870 gbtsa34.seq 1500000047 gbtsa35.seq 1499998598 gbtsa36.seq 178457327 gbtsa37.seq 1500000035 gbtsa4.seq 1499999204 gbtsa5.seq 1499998406 gbtsa6.seq 1499998817 gbtsa7.seq 1499997461 gbtsa8.seq 1499996435 gbtsa9.seq 8153170 gbuna1.seq 1499993938 gbvrl1.seq 1497659731 gbvrl10.seq 1499993440 gbvrl100.seq 1499962143 gbvrl101.seq 1499969841 gbvrl102.seq 1499984920 gbvrl103.seq 1499942714 gbvrl104.seq 1499948967 gbvrl105.seq 1499944301 gbvrl106.seq 1499976040 gbvrl107.seq 1499979463 gbvrl108.seq 1499935025 gbvrl109.seq 1499999214 gbvrl11.seq 1499949734 gbvrl110.seq 1499987637 gbvrl111.seq 1499946361 gbvrl112.seq 1499950205 gbvrl113.seq 1499999197 gbvrl114.seq 1499967115 gbvrl115.seq 1499939139 gbvrl116.seq 1499990300 gbvrl117.seq 1499949303 gbvrl118.seq 1499969365 gbvrl119.seq 1499997937 gbvrl12.seq 1499991753 gbvrl120.seq 1499946039 gbvrl121.seq 1499956961 gbvrl122.seq 1499973257 gbvrl123.seq 1499972519 gbvrl124.seq 1499938204 gbvrl125.seq 1499971654 gbvrl126.seq 1500000265 gbvrl127.seq 1499981644 gbvrl128.seq 1499987390 gbvrl129.seq 1499973026 gbvrl13.seq 1499948583 gbvrl130.seq 1499994781 gbvrl131.seq 1499974955 gbvrl132.seq 1499979265 gbvrl133.seq 1499937285 gbvrl134.seq 1499997292 gbvrl135.seq 1499997177 gbvrl136.seq 1499941307 gbvrl137.seq 1499975317 gbvrl138.seq 1499949989 gbvrl139.seq 1500000176 gbvrl14.seq 1499992613 gbvrl140.seq 1499937099 gbvrl141.seq 1499935506 gbvrl142.seq 1499951591 gbvrl143.seq 1499974502 gbvrl144.seq 1499979258 gbvrl145.seq 1499965506 gbvrl146.seq 1499981045 gbvrl147.seq 1499964343 gbvrl148.seq 1499964332 gbvrl149.seq 1499950393 gbvrl15.seq 1499972511 gbvrl150.seq 1499944604 gbvrl151.seq 1499988120 gbvrl152.seq 1499963625 gbvrl153.seq 1499943053 gbvrl154.seq 1499975700 gbvrl155.seq 1499990979 gbvrl156.seq 1500000152 gbvrl157.seq 1499952354 gbvrl158.seq 1499990903 gbvrl159.seq 1499941481 gbvrl16.seq 1499949468 gbvrl160.seq 1499978418 gbvrl161.seq 1499990674 gbvrl162.seq 1499999672 gbvrl163.seq 1499999205 gbvrl164.seq 1499934164 gbvrl165.seq 1499997508 gbvrl166.seq 1499997310 gbvrl167.seq 1499942154 gbvrl168.seq 1499977314 gbvrl169.seq 1499978919 gbvrl17.seq 1499975002 gbvrl170.seq 1499886607 gbvrl171.seq 1499971346 gbvrl172.seq 1499944345 gbvrl173.seq 1499986393 gbvrl174.seq 1499944539 gbvrl175.seq 1499982067 gbvrl176.seq 1499955407 gbvrl177.seq 1499949994 gbvrl178.seq 1499963381 gbvrl179.seq 1499998679 gbvrl18.seq 1499946089 gbvrl180.seq 1499964187 gbvrl181.seq 1499944778 gbvrl182.seq 1499974241 gbvrl183.seq 1499979746 gbvrl184.seq 1499990886 gbvrl185.seq 1499957221 gbvrl186.seq 1499959764 gbvrl187.seq 1499965341 gbvrl188.seq 1499991392 gbvrl189.seq 1499972478 gbvrl19.seq 1499992616 gbvrl190.seq 1499998561 gbvrl191.seq 1499994619 gbvrl192.seq 1499965581 gbvrl193.seq 1499967938 gbvrl194.seq 1499976935 gbvrl195.seq 1499970904 gbvrl196.seq 1499992006 gbvrl197.seq 1499967046 gbvrl198.seq 1499977090 gbvrl199.seq 1499997186 gbvrl2.seq 1499983276 gbvrl20.seq 1499969405 gbvrl200.seq 1499987960 gbvrl201.seq 1499957546 gbvrl202.seq 1499980695 gbvrl203.seq 1499963952 gbvrl204.seq 1499976419 gbvrl205.seq 1499963972 gbvrl206.seq 1499995909 gbvrl207.seq 1499965308 gbvrl208.seq 1499971035 gbvrl209.seq 1499958032 gbvrl21.seq 1499998540 gbvrl210.seq 1499996755 gbvrl211.seq 1499986999 gbvrl212.seq 1499989156 gbvrl213.seq 1499992974 gbvrl214.seq 1499993805 gbvrl215.seq 1499965284 gbvrl216.seq 1499998358 gbvrl217.seq 1499992510 gbvrl218.seq 1499997758 gbvrl219.seq 1499994761 gbvrl22.seq 1499968628 gbvrl220.seq 1499999810 gbvrl221.seq 1499990902 gbvrl222.seq 1499976426 gbvrl223.seq 1499981653 gbvrl224.seq 1499979911 gbvrl225.seq 1499993586 gbvrl226.seq 1499991417 gbvrl227.seq 1499993664 gbvrl228.seq 1499988328 gbvrl229.seq 1499948335 gbvrl23.seq 1499975990 gbvrl230.seq 1499966323 gbvrl231.seq 1499977283 gbvrl232.seq 1499990223 gbvrl233.seq 1499996654 gbvrl234.seq 1499960364 gbvrl235.seq 1499988874 gbvrl236.seq 1499990383 gbvrl237.seq 1499992734 gbvrl238.seq 1499964104 gbvrl239.seq 1499996276 gbvrl24.seq 1499970204 gbvrl240.seq 1499980827 gbvrl241.seq 1499995896 gbvrl242.seq 1499985824 gbvrl243.seq 1499978226 gbvrl244.seq 1499964935 gbvrl245.seq 1499980816 gbvrl246.seq 1499983834 gbvrl247.seq 1499969094 gbvrl248.seq 1499992163 gbvrl249.seq 1499975810 gbvrl25.seq 1499970945 gbvrl250.seq 1499966180 gbvrl251.seq 1499981566 gbvrl252.seq 1499982239 gbvrl253.seq 1499998756 gbvrl254.seq 1499965403 gbvrl255.seq 1499995847 gbvrl256.seq 1499962303 gbvrl257.seq 1499963366 gbvrl258.seq 1499977854 gbvrl259.seq 1499970618 gbvrl26.seq 1499976231 gbvrl260.seq 1499964098 gbvrl261.seq 1499982861 gbvrl262.seq 1499973883 gbvrl263.seq 1499995550 gbvrl264.seq 1499964533 gbvrl265.seq 1499979514 gbvrl266.seq 1499991985 gbvrl267.seq 1499985130 gbvrl268.seq 1499963747 gbvrl269.seq 1499979174 gbvrl27.seq 1499980900 gbvrl270.seq 1499981513 gbvrl271.seq 1499965564 gbvrl272.seq 1499959311 gbvrl273.seq 1499968027 gbvrl274.seq 1499997035 gbvrl275.seq 1499987452 gbvrl276.seq 1499988092 gbvrl277.seq 1499984123 gbvrl278.seq 1499975863 gbvrl279.seq 1499980742 gbvrl28.seq 1499994183 gbvrl280.seq 1499964241 gbvrl281.seq 1499987455 gbvrl282.seq 1499994781 gbvrl283.seq 1499975569 gbvrl284.seq 1499973575 gbvrl285.seq 1499961744 gbvrl286.seq 1499995787 gbvrl287.seq 1499992141 gbvrl288.seq 1499992799 gbvrl289.seq 1499981453 gbvrl29.seq 1499984402 gbvrl290.seq 1499986162 gbvrl291.seq 1499986220 gbvrl292.seq 1499992323 gbvrl293.seq 1499986829 gbvrl294.seq 1499999200 gbvrl295.seq 1499978073 gbvrl296.seq 1499996822 gbvrl297.seq 1499965809 gbvrl298.seq 1499988000 gbvrl299.seq 1499996959 gbvrl3.seq 1499961241 gbvrl30.seq 1500000229 gbvrl300.seq 1499979239 gbvrl301.seq 1499990214 gbvrl302.seq 1499994883 gbvrl303.seq 1499997580 gbvrl304.seq 1499992078 gbvrl305.seq 1499993934 gbvrl306.seq 1499999770 gbvrl307.seq 1499963436 gbvrl308.seq 1499977452 gbvrl309.seq 1499936233 gbvrl31.seq 1499995403 gbvrl310.seq 1499997356 gbvrl311.seq 1499961216 gbvrl312.seq 1499990163 gbvrl313.seq 1499965728 gbvrl314.seq 1499965064 gbvrl315.seq 1499967985 gbvrl316.seq 1499983628 gbvrl317.seq 1499960692 gbvrl318.seq 1499875081 gbvrl319.seq 1499955060 gbvrl32.seq 1499977944 gbvrl320.seq 1499995265 gbvrl321.seq 1499951014 gbvrl322.seq 1499979931 gbvrl323.seq 1499978309 gbvrl324.seq 1499934307 gbvrl325.seq 1499983527 gbvrl326.seq 1499976871 gbvrl327.seq 1499969720 gbvrl328.seq 1499936116 gbvrl329.seq 1499968975 gbvrl33.seq 1499957894 gbvrl330.seq 1499714700 gbvrl331.seq 1499992158 gbvrl332.seq 1499964754 gbvrl333.seq 1499953429 gbvrl334.seq 1499992133 gbvrl335.seq 1499998976 gbvrl336.seq 1499936271 gbvrl337.seq 1499999282 gbvrl338.seq 1499998492 gbvrl339.seq 1499993594 gbvrl34.seq 1499986945 gbvrl340.seq 1499993492 gbvrl341.seq 1499934923 gbvrl342.seq 1499958086 gbvrl343.seq 1499996092 gbvrl344.seq 17815501 gbvrl345.seq 1499951198 gbvrl35.seq 1499974672 gbvrl36.seq 1499975226 gbvrl37.seq 1499953844 gbvrl38.seq 1499995726 gbvrl39.seq 1499983648 gbvrl4.seq 1499984845 gbvrl40.seq 1499978395 gbvrl41.seq 1499960873 gbvrl42.seq 1499994056 gbvrl43.seq 1499958276 gbvrl44.seq 1499990491 gbvrl45.seq 1499995996 gbvrl46.seq 1499986020 gbvrl47.seq 1499974761 gbvrl48.seq 1499980084 gbvrl49.seq 1499995800 gbvrl5.seq 1499959007 gbvrl50.seq 1499946549 gbvrl51.seq 1499950779 gbvrl52.seq 1499964313 gbvrl53.seq 1499963953 gbvrl54.seq 1499939714 gbvrl55.seq 1499942676 gbvrl56.seq 1499936116 gbvrl57.seq 1499985994 gbvrl58.seq 1499942233 gbvrl59.seq 1499998101 gbvrl6.seq 1499936470 gbvrl60.seq 1499983961 gbvrl61.seq 1499940674 gbvrl62.seq 1499987743 gbvrl63.seq 1499987336 gbvrl64.seq 1499994991 gbvrl65.seq 1499981872 gbvrl66.seq 1499981849 gbvrl67.seq 1499955842 gbvrl68.seq 1499978869 gbvrl69.seq 1499997695 gbvrl7.seq 1499957434 gbvrl70.seq 1499999501 gbvrl71.seq 1499968812 gbvrl72.seq 1499970226 gbvrl73.seq 1499960755 gbvrl74.seq 1499995298 gbvrl75.seq 1499943132 gbvrl76.seq 1499996402 gbvrl77.seq 1499991267 gbvrl78.seq 1499935512 gbvrl79.seq 1499996896 gbvrl8.seq 1499939206 gbvrl80.seq 1499941366 gbvrl81.seq 1499938994 gbvrl82.seq 1499971047 gbvrl83.seq 1499940209 gbvrl84.seq 1499982552 gbvrl85.seq 1499997847 gbvrl86.seq 1499937577 gbvrl87.seq 1499994526 gbvrl88.seq 1499946809 gbvrl89.seq 1499978723 gbvrl9.seq 1499966796 gbvrl90.seq 1499936562 gbvrl91.seq 1499991175 gbvrl92.seq 1499975488 gbvrl93.seq 1499981540 gbvrl94.seq 1499981923 gbvrl95.seq 1499958238 gbvrl96.seq 1499953375 gbvrl97.seq 1499996512 gbvrl98.seq 1499934888 gbvrl99.seq 1468819733 gbvrt1.seq 1490552672 gbvrt10.seq 1492454612 gbvrt100.seq 1491368790 gbvrt101.seq 1495295998 gbvrt102.seq 1432140919 gbvrt103.seq 1476737913 gbvrt104.seq 1492159548 gbvrt105.seq 1460277083 gbvrt106.seq 896244705 gbvrt107.seq 1262095184 gbvrt108.seq 1090722360 gbvrt109.seq 1481230184 gbvrt11.seq 1424049174 gbvrt110.seq 1496909957 gbvrt111.seq 1493025075 gbvrt112.seq 1320575219 gbvrt113.seq 1436638097 gbvrt114.seq 1458922406 gbvrt115.seq 1491575244 gbvrt116.seq 1281300277 gbvrt117.seq 1411652468 gbvrt118.seq 1421545558 gbvrt119.seq 1465613590 gbvrt12.seq 1476891269 gbvrt120.seq 1386060829 gbvrt121.seq 1433021643 gbvrt122.seq 1497612563 gbvrt123.seq 1486330678 gbvrt124.seq 1462604299 gbvrt125.seq 1476857854 gbvrt126.seq 1488438777 gbvrt127.seq 1462478284 gbvrt128.seq 1498078979 gbvrt129.seq 1442470543 gbvrt13.seq 1484861739 gbvrt130.seq 1477143564 gbvrt131.seq 1483219404 gbvrt132.seq 1463588150 gbvrt133.seq 1491354277 gbvrt134.seq 1497114650 gbvrt135.seq 1478208496 gbvrt136.seq 1462060438 gbvrt137.seq 1385911851 gbvrt138.seq 1470368193 gbvrt139.seq 1357666879 gbvrt14.seq 1487646132 gbvrt140.seq 1420160724 gbvrt141.seq 1491622767 gbvrt142.seq 1480809421 gbvrt143.seq 1474599966 gbvrt144.seq 1498459033 gbvrt145.seq 1436819628 gbvrt146.seq 1480754470 gbvrt147.seq 1473702580 gbvrt148.seq 1483456760 gbvrt149.seq 1411930103 gbvrt15.seq 1460587689 gbvrt150.seq 1491277907 gbvrt151.seq 1433698722 gbvrt152.seq 1392969255 gbvrt153.seq 1458594989 gbvrt154.seq 1497316015 gbvrt155.seq 1416739574 gbvrt156.seq 1485249531 gbvrt157.seq 1468995634 gbvrt158.seq 1495839785 gbvrt159.seq 1360172986 gbvrt16.seq 1361029027 gbvrt160.seq 1454564111 gbvrt161.seq 1463902579 gbvrt162.seq 1483704335 gbvrt163.seq 1320939305 gbvrt164.seq 1450812981 gbvrt165.seq 1478017801 gbvrt166.seq 1392442116 gbvrt167.seq 1496121979 gbvrt168.seq 1429716567 gbvrt169.seq 1497539782 gbvrt17.seq 1495014546 gbvrt170.seq 1444533644 gbvrt171.seq 1472525288 gbvrt172.seq 1371889473 gbvrt173.seq 1463585704 gbvrt174.seq 1458123750 gbvrt175.seq 1393009098 gbvrt176.seq 1339390452 gbvrt177.seq 1446769447 gbvrt178.seq 1432904863 gbvrt179.seq 1488196565 gbvrt18.seq 1469966670 gbvrt180.seq 1484040009 gbvrt181.seq 1496855706 gbvrt182.seq 1433040470 gbvrt183.seq 1375266246 gbvrt184.seq 1483347947 gbvrt185.seq 1364574160 gbvrt186.seq 1442347330 gbvrt187.seq 1494535064 gbvrt188.seq 1440727248 gbvrt189.seq 1425455009 gbvrt19.seq 1472724385 gbvrt190.seq 1399605061 gbvrt191.seq 1291348384 gbvrt192.seq 1492986566 gbvrt193.seq 1497829903 gbvrt194.seq 1436699186 gbvrt195.seq 1173719027 gbvrt196.seq 1470502273 gbvrt197.seq 1336897357 gbvrt198.seq 1451022601 gbvrt199.seq 1488073608 gbvrt2.seq 1466789876 gbvrt20.seq 1496444625 gbvrt200.seq 1452606394 gbvrt201.seq 1498405608 gbvrt202.seq 1458261551 gbvrt203.seq 1422476619 gbvrt204.seq 1465708115 gbvrt205.seq 1479745451 gbvrt206.seq 1495244154 gbvrt207.seq 1468455350 gbvrt208.seq 1484551004 gbvrt209.seq 1462228637 gbvrt21.seq 1341285709 gbvrt210.seq 1391197933 gbvrt211.seq 1409281737 gbvrt212.seq 1244065593 gbvrt213.seq 1487136121 gbvrt214.seq 1490014032 gbvrt215.seq 1493866969 gbvrt216.seq 1487060040 gbvrt217.seq 1485132106 gbvrt218.seq 1449198453 gbvrt219.seq 1499906876 gbvrt22.seq 1499714857 gbvrt220.seq 1410198280 gbvrt221.seq 1147311112 gbvrt222.seq 1750969594 gbvrt223.seq 1582584122 gbvrt224.seq 1439178988 gbvrt225.seq 1385914538 gbvrt226.seq 1260623871 gbvrt227.seq 1241027078 gbvrt228.seq 1394205943 gbvrt229.seq 1499998830 gbvrt23.seq 647635060 gbvrt230.seq 1800655812 gbvrt231.seq 1625880297 gbvrt232.seq 1452341451 gbvrt233.seq 1413268707 gbvrt234.seq 1301679404 gbvrt235.seq 1265017882 gbvrt236.seq 1398329117 gbvrt237.seq 646313711 gbvrt238.seq 2486764648 gbvrt239.seq 1497899045 gbvrt24.seq 2399841711 gbvrt240.seq 2168065652 gbvrt241.seq 1730481357 gbvrt242.seq 1674077467 gbvrt243.seq 1643880041 gbvrt244.seq 1613167793 gbvrt245.seq 1585967368 gbvrt246.seq 1573317635 gbvrt247.seq 1525189779 gbvrt248.seq 1522308102 gbvrt249.seq 1499998003 gbvrt25.seq 1503557506 gbvrt250.seq 1502833827 gbvrt251.seq 1439581620 gbvrt252.seq 1297818631 gbvrt253.seq 1258324368 gbvrt254.seq 1369247334 gbvrt255.seq 1368865938 gbvrt256.seq 1472115430 gbvrt257.seq 1449680126 gbvrt258.seq 1309689855 gbvrt259.seq 1499990291 gbvrt26.seq 1469430849 gbvrt260.seq 1466100957 gbvrt261.seq 1392101492 gbvrt262.seq 1390671725 gbvrt263.seq 1408841519 gbvrt264.seq 1498224495 gbvrt265.seq 1475026708 gbvrt266.seq 1464576040 gbvrt267.seq 1459906041 gbvrt268.seq 1465282649 gbvrt269.seq 1499999116 gbvrt27.seq 286802878 gbvrt270.seq 2737865440 gbvrt271.seq 582597811 gbvrt272.seq 2729824435 gbvrt273.seq 666748676 gbvrt274.seq 2720117404 gbvrt275.seq 646964638 gbvrt276.seq 2731547963 gbvrt277.seq 195179179 gbvrt278.seq 2734657827 gbvrt279.seq 1486159709 gbvrt28.seq 21623841 gbvrt280.seq 2728895745 gbvrt281.seq 2505979018 gbvrt282.seq 2204702755 gbvrt283.seq 1642333222 gbvrt284.seq 1549476405 gbvrt285.seq 1535228181 gbvrt286.seq 1466613005 gbvrt287.seq 1478204774 gbvrt288.seq 1470950309 gbvrt289.seq 1499999079 gbvrt29.seq 186687778 gbvrt290.seq 2736013151 gbvrt291.seq 466831313 gbvrt292.seq 2724707547 gbvrt293.seq 428842069 gbvrt294.seq 2726904396 gbvrt295.seq 418344636 gbvrt296.seq 2737394570 gbvrt297.seq 32900508 gbvrt298.seq 2595542382 gbvrt299.seq 1487660705 gbvrt3.seq 1499810449 gbvrt30.seq 2455087006 gbvrt300.seq 2265220339 gbvrt301.seq 2012454031 gbvrt302.seq 1582208555 gbvrt303.seq 1469382459 gbvrt304.seq 1410611776 gbvrt305.seq 1422258498 gbvrt306.seq 1462005873 gbvrt307.seq 1484741498 gbvrt308.seq 1485090184 gbvrt309.seq 1472439172 gbvrt31.seq 1490726491 gbvrt310.seq 1409295542 gbvrt311.seq 1415524312 gbvrt312.seq 1419887839 gbvrt313.seq 1489004865 gbvrt314.seq 1440469467 gbvrt315.seq 1434214929 gbvrt316.seq 1463440865 gbvrt317.seq 1461640335 gbvrt318.seq 1416024276 gbvrt319.seq 1451008268 gbvrt32.seq 1472880226 gbvrt320.seq 1486571850 gbvrt321.seq 1457522589 gbvrt322.seq 1469858789 gbvrt323.seq 1275996161 gbvrt324.seq 1473886314 gbvrt325.seq 1407628850 gbvrt326.seq 1470508850 gbvrt327.seq 1490724356 gbvrt328.seq 1487540532 gbvrt329.seq 1499026252 gbvrt33.seq 1427325051 gbvrt330.seq 1439839498 gbvrt331.seq 1072255647 gbvrt332.seq 1417155344 gbvrt333.seq 1328714210 gbvrt334.seq 1135819087 gbvrt335.seq 952384782 gbvrt336.seq 872251544 gbvrt337.seq 858760811 gbvrt338.seq 1138273420 gbvrt339.seq 1497649218 gbvrt34.seq 1420474204 gbvrt340.seq 1408136024 gbvrt341.seq 1486210615 gbvrt342.seq 1489796585 gbvrt343.seq 1401076841 gbvrt344.seq 1473258470 gbvrt345.seq 1404838293 gbvrt346.seq 1473583203 gbvrt347.seq 1404913548 gbvrt348.seq 1477020194 gbvrt349.seq 1149369672 gbvrt35.seq 1397059913 gbvrt350.seq 1475549804 gbvrt351.seq 1410126884 gbvrt352.seq 1472429474 gbvrt353.seq 1388472387 gbvrt354.seq 1444039874 gbvrt355.seq 1448790743 gbvrt356.seq 1444806391 gbvrt357.seq 1354493522 gbvrt358.seq 1475110803 gbvrt359.seq 1423257163 gbvrt36.seq 1407513438 gbvrt360.seq 1470754045 gbvrt361.seq 1410492150 gbvrt362.seq 1451274358 gbvrt363.seq 1491827559 gbvrt364.seq 1469217906 gbvrt365.seq 1431508692 gbvrt366.seq 1465875271 gbvrt367.seq 1492092147 gbvrt368.seq 1489236528 gbvrt369.seq 1389228052 gbvrt37.seq 1431830177 gbvrt370.seq 1408044624 gbvrt371.seq 1479094683 gbvrt372.seq 1478403648 gbvrt373.seq 1496962575 gbvrt374.seq 1482125609 gbvrt375.seq 1480007582 gbvrt376.seq 1462048160 gbvrt377.seq 1489631834 gbvrt378.seq 1467867486 gbvrt379.seq 1467789570 gbvrt38.seq 1221284964 gbvrt380.seq 1393845451 gbvrt381.seq 1428120823 gbvrt382.seq 1390966277 gbvrt383.seq 1351498425 gbvrt384.seq 1346310370 gbvrt385.seq 1481311708 gbvrt386.seq 1487234842 gbvrt387.seq 1367267779 gbvrt388.seq 1482474115 gbvrt389.seq 1490583831 gbvrt39.seq 1473198814 gbvrt390.seq 1485655241 gbvrt391.seq 1465537646 gbvrt392.seq 1498352825 gbvrt393.seq 1452420537 gbvrt394.seq 1499581995 gbvrt395.seq 1405469990 gbvrt396.seq 1462831081 gbvrt397.seq 1387786791 gbvrt398.seq 1460116530 gbvrt399.seq 1468110869 gbvrt4.seq 1048495703 gbvrt40.seq 1463364218 gbvrt400.seq 1466761052 gbvrt401.seq 1474907543 gbvrt402.seq 1484337526 gbvrt403.seq 1488915586 gbvrt404.seq 1489982193 gbvrt405.seq 1491678527 gbvrt406.seq 1471156049 gbvrt407.seq 1364883283 gbvrt408.seq 1466059588 gbvrt409.seq 1063697372 gbvrt41.seq 1433946235 gbvrt410.seq 1457813132 gbvrt411.seq 1211504142 gbvrt412.seq 1484767355 gbvrt413.seq 1402052694 gbvrt414.seq 1388694647 gbvrt415.seq 1493784267 gbvrt416.seq 1445947000 gbvrt417.seq 1408721211 gbvrt418.seq 1365320010 gbvrt419.seq 1045817455 gbvrt42.seq 1335187196 gbvrt420.seq 1434807079 gbvrt421.seq 1482815373 gbvrt422.seq 1493104228 gbvrt423.seq 1456914765 gbvrt424.seq 1465177756 gbvrt425.seq 1354731927 gbvrt426.seq 1377885857 gbvrt427.seq 1306093102 gbvrt428.seq 1439258793 gbvrt429.seq 1371630420 gbvrt43.seq 1446499400 gbvrt430.seq 1362562724 gbvrt431.seq 1462223295 gbvrt432.seq 1469876767 gbvrt433.seq 1435670402 gbvrt434.seq 1463242615 gbvrt435.seq 1447291218 gbvrt436.seq 1457968251 gbvrt437.seq 1383728736 gbvrt438.seq 1489176327 gbvrt439.seq 1358087426 gbvrt44.seq 1315126916 gbvrt440.seq 1443084955 gbvrt441.seq 1481483923 gbvrt442.seq 1495584089 gbvrt443.seq 1473825125 gbvrt444.seq 1392279265 gbvrt445.seq 1473756179 gbvrt446.seq 1426333180 gbvrt447.seq 1376827267 gbvrt448.seq 1452697882 gbvrt449.seq 1409890116 gbvrt45.seq 1465327398 gbvrt450.seq 1421101487 gbvrt451.seq 1476339376 gbvrt452.seq 1338156710 gbvrt453.seq 1449954747 gbvrt454.seq 1415867797 gbvrt455.seq 1461592666 gbvrt456.seq 1469979325 gbvrt457.seq 1437233423 gbvrt458.seq 1442479844 gbvrt459.seq 1495658777 gbvrt46.seq 1415676103 gbvrt460.seq 1380303260 gbvrt461.seq 1364451638 gbvrt462.seq 1292693681 gbvrt463.seq 1437659744 gbvrt464.seq 1484149004 gbvrt465.seq 1499980418 gbvrt466.seq 1440440954 gbvrt467.seq 1409987260 gbvrt468.seq 1440864690 gbvrt469.seq 1468214202 gbvrt47.seq 1459727744 gbvrt470.seq 1479473283 gbvrt471.seq 1461432733 gbvrt472.seq 1489305963 gbvrt473.seq 1444180996 gbvrt474.seq 1441161475 gbvrt475.seq 1402754077 gbvrt476.seq 1430527087 gbvrt477.seq 1436043608 gbvrt478.seq 1487063616 gbvrt479.seq 1497507497 gbvrt48.seq 1482315352 gbvrt480.seq 1483839448 gbvrt481.seq 1493702132 gbvrt482.seq 1344300596 gbvrt483.seq 1450152194 gbvrt484.seq 1388442806 gbvrt485.seq 1446934711 gbvrt486.seq 1288708312 gbvrt487.seq 1450942426 gbvrt488.seq 1494015738 gbvrt489.seq 1392041424 gbvrt49.seq 1466182162 gbvrt490.seq 1477581665 gbvrt491.seq 1476493115 gbvrt492.seq 1468442871 gbvrt493.seq 1489501861 gbvrt494.seq 1495114178 gbvrt495.seq 1480967132 gbvrt496.seq 1480568639 gbvrt497.seq 1457603384 gbvrt498.seq 1497600355 gbvrt499.seq 1492778301 gbvrt5.seq 838606763 gbvrt50.seq 1170690398 gbvrt500.seq 1446300573 gbvrt501.seq 1444622009 gbvrt502.seq 1438436698 gbvrt503.seq 1482393905 gbvrt504.seq 1475049771 gbvrt505.seq 1491270270 gbvrt506.seq 1496178169 gbvrt507.seq 1499504302 gbvrt508.seq 1461004061 gbvrt509.seq 1154852032 gbvrt51.seq 1408010069 gbvrt510.seq 1470927858 gbvrt511.seq 1496771400 gbvrt512.seq 1465104953 gbvrt513.seq 1454947458 gbvrt514.seq 1493774156 gbvrt515.seq 1496289862 gbvrt516.seq 1474666635 gbvrt517.seq 1492369720 gbvrt518.seq 1499061951 gbvrt519.seq 1294541035 gbvrt52.seq 1483148569 gbvrt520.seq 1490333414 gbvrt521.seq 1415080428 gbvrt522.seq 1490573681 gbvrt523.seq 1472982479 gbvrt524.seq 1498129659 gbvrt525.seq 1484516635 gbvrt526.seq 1454185989 gbvrt527.seq 1437007020 gbvrt528.seq 1489249473 gbvrt529.seq 1495334811 gbvrt53.seq 1389502465 gbvrt530.seq 1475952029 gbvrt531.seq 1423957395 gbvrt532.seq 1495721527 gbvrt533.seq 1492716357 gbvrt534.seq 1483312075 gbvrt535.seq 1486100548 gbvrt536.seq 1450629938 gbvrt537.seq 1493650234 gbvrt538.seq 836333325 gbvrt539.seq 1471849771 gbvrt54.seq 780132175 gbvrt540.seq 1399844426 gbvrt541.seq 1098006519 gbvrt542.seq 1356755336 gbvrt543.seq 759518532 gbvrt544.seq 1398766699 gbvrt545.seq 1104373173 gbvrt546.seq 1486765594 gbvrt547.seq 1482802613 gbvrt548.seq 1415229561 gbvrt549.seq 1495075479 gbvrt55.seq 1476094210 gbvrt550.seq 1487480076 gbvrt551.seq 1491961383 gbvrt552.seq 1464679772 gbvrt553.seq 1475160868 gbvrt554.seq 1468717527 gbvrt555.seq 1495524740 gbvrt556.seq 1460098456 gbvrt557.seq 1418731735 gbvrt558.seq 1490292771 gbvrt559.seq 1443062910 gbvrt56.seq 1460391569 gbvrt560.seq 1408894594 gbvrt561.seq 1496380006 gbvrt562.seq 1487415520 gbvrt563.seq 1483923279 gbvrt564.seq 1470336557 gbvrt565.seq 1471958602 gbvrt566.seq 1489879617 gbvrt567.seq 1473770299 gbvrt568.seq 1491732095 gbvrt569.seq 1495785632 gbvrt57.seq 1459131705 gbvrt570.seq 1363664280 gbvrt571.seq 1462695952 gbvrt572.seq 1491816501 gbvrt573.seq 1484314112 gbvrt574.seq 1499998524 gbvrt575.seq 1465454859 gbvrt576.seq 1499047207 gbvrt577.seq 1473529159 gbvrt578.seq 1499988894 gbvrt579.seq 1476010173 gbvrt58.seq 69870191 gbvrt580.seq 1465137891 gbvrt59.seq 1488776542 gbvrt6.seq 1282827346 gbvrt60.seq 1432076919 gbvrt61.seq 1499422661 gbvrt62.seq 1473624134 gbvrt63.seq 1494431972 gbvrt64.seq 1230349555 gbvrt65.seq 1413618697 gbvrt66.seq 1330262106 gbvrt67.seq 1463202068 gbvrt68.seq 1491604647 gbvrt69.seq 1499999157 gbvrt7.seq 1469825980 gbvrt70.seq 1495977022 gbvrt71.seq 1412203616 gbvrt72.seq 1485152845 gbvrt73.seq 1492545763 gbvrt74.seq 1464128130 gbvrt75.seq 1492487296 gbvrt76.seq 1482511853 gbvrt77.seq 1495647980 gbvrt78.seq 1459032464 gbvrt79.seq 1482837471 gbvrt8.seq 1488292341 gbvrt80.seq 1457767903 gbvrt81.seq 432471550 gbvrt82.seq 1068402515 gbvrt83.seq 1067356332 gbvrt84.seq 896844818 gbvrt85.seq 805318346 gbvrt86.seq 1275607077 gbvrt87.seq 1208361643 gbvrt88.seq 874873714 gbvrt89.seq 1494629942 gbvrt9.seq 1313422786 gbvrt90.seq 1438940816 gbvrt91.seq 1490321479 gbvrt92.seq 1346742038 gbvrt93.seq 1478309843 gbvrt94.seq 1499997408 gbvrt95.seq 1499997600 gbvrt96.seq 1498531491 gbvrt97.seq 1478099366 gbvrt98.seq 1497750802 gbvrt99.seq 2.2.6 Per-Division Statistics The following table provides a per-division breakdown of the number of sequence entries and the total number of bases of DNA/RNA in each non-CON and non-WGS sequence data file. CON division records, which are constructed from other sequence records, are not represented here because their inclusion would essentially be a form of double-counting. Sequences from Whole Genome Shotgun (WGS) sequencing projects are not represented here because all WGS project data are made available on a per-project basis: ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs ftp://ftp.ncbi.nih.gov/genbank/wgs rather than being incorporated within the GenBank release distribution. Division Entries Bases BCT1 179386 601495082 BCT10 345 679333600 BCT100 282 693558817 BCT101 442 657174055 BCT102 381 689282321 BCT103 371 721665511 BCT104 337 670613443 BCT105 450 662636355 BCT106 310 678820496 BCT107 311 692035089 BCT108 248 672849355 BCT109 334 667978205 BCT11 380 743372895 BCT110 379 664000123 BCT111 295 697645459 BCT112 382 704086034 BCT113 410 660454908 BCT114 446 749560796 BCT115 340 671703796 BCT116 1266 690974017 BCT117 367 680266760 BCT118 345 648625518 BCT119 540 673807411 BCT12 435 756186348 BCT120 419 666385469 BCT121 374 685580236 BCT122 375 692141962 BCT123 353 678417074 BCT124 331 685077049 BCT125 203 666436933 BCT126 482 711939176 BCT127 471 689825574 BCT128 232 691690101 BCT129 303 663910512 BCT13 454 676857766 BCT130 396 704944722 BCT131 407 715340652 BCT132 611 709462490 BCT133 377 706985746 BCT134 303 682255090 BCT135 374 673065189 BCT136 319 669863786 BCT137 365 846824343 BCT138 369 675451129 BCT139 350 669317619 BCT14 572 676477931 BCT140 395 681254394 BCT141 405 675723346 BCT142 447 690592939 BCT143 382 667432996 BCT144 330 715418240 BCT145 341 729694743 BCT146 317 690632961 BCT147 313 680328454 BCT148 362 678950318 BCT149 400 683665765 BCT15 522 674218403 BCT150 518 647120971 BCT151 354 727140499 BCT152 352 716431374 BCT153 291 668135540 BCT154 370 662381386 BCT155 330 668546959 BCT156 504 648278700 BCT157 704 643023757 BCT158 469 650703441 BCT159 490 640713825 BCT16 489 674873332 BCT160 431 636576254 BCT161 417 639209335 BCT162 420 677904514 BCT163 513 697482768 BCT164 353 672446813 BCT165 430 706205261 BCT166 296 675751480 BCT167 308 746224157 BCT168 441 677632174 BCT169 429 667418583 BCT17 301 669754936 BCT170 391 703325884 BCT171 376 657010366 BCT172 312 657469731 BCT173 522 806194464 BCT174 439 746836872 BCT175 428 675336571 BCT176 282 660437990 BCT177 353 674619955 BCT178 415 657135432 BCT179 546 670896157 BCT18 307 675459949 BCT180 324 691014409 BCT181 471 650442589 BCT182 455 669454811 BCT183 425 657768213 BCT184 451 703044708 BCT185 342 668214176 BCT186 514 704174003 BCT187 324 744206261 BCT188 394 681500314 BCT189 350 666685059 BCT19 101 674386867 BCT190 263 664876832 BCT191 325 674955975 BCT192 433 674357039 BCT193 416 707927487 BCT194 491 676638884 BCT195 353 662953738 BCT196 321 648211708 BCT197 319 653070961 BCT198 379 638391634 BCT199 431 706981210 BCT2 26411 630242241 BCT20 345 672763210 BCT200 298 697214982 BCT201 295 671326703 BCT202 302 660191564 BCT203 414 655699841 BCT204 340 647076961 BCT205 411 681269220 BCT206 377 678067500 BCT207 357 799265717 BCT208 378 900221645 BCT209 393 661056570 BCT21 359 674107834 BCT210 438 650571217 BCT211 404 727564270 BCT212 350 701961672 BCT213 459 703735740 BCT214 540 658375436 BCT215 392 701634371 BCT216 400 638641469 BCT217 418 643651668 BCT218 423 693325233 BCT219 408 680024430 BCT22 361 669265934 BCT220 437 693448897 BCT221 376 657548771 BCT222 422 688786530 BCT223 244 652422111 BCT224 306 654535816 BCT225 379 679928843 BCT226 477 654231276 BCT227 414 694527357 BCT228 303 656033219 BCT229 379 653483811 BCT23 385 705746323 BCT230 388 638076117 BCT231 335 663486151 BCT232 323 712525832 BCT233 379 683750302 BCT234 347 670611259 BCT235 352 685362060 BCT236 332 663920479 BCT237 388 645243519 BCT238 406 670671815 BCT239 312 656598930 BCT24 253 678802401 BCT240 328 639006150 BCT241 335 651475396 BCT242 313 625790270 BCT243 371 650816603 BCT244 384 649512504 BCT245 583 671363967 BCT246 363 644508981 BCT247 318 711603552 BCT248 306 635771351 BCT249 341 644219726 BCT25 404 662387090 BCT250 315 664555102 BCT251 362 636793041 BCT252 395 632988972 BCT253 408 621643194 BCT254 327 614397776 BCT255 329 640214935 BCT256 492 734201178 BCT257 369 652629412 BCT258 495 661094893 BCT259 400 653318816 BCT26 328 678951506 BCT260 318 648827748 BCT261 305 650937892 BCT262 353 661474760 BCT263 380 686234283 BCT264 394 627320815 BCT265 316 644968014 BCT266 385 629134666 BCT267 335 653542049 BCT268 316 676986278 BCT269 486 747670123 BCT27 272 671342802 BCT270 146 645110315 BCT271 103 646074529 BCT272 129 646490760 BCT273 122 646876017 BCT274 133 651506070 BCT275 151 648216197 BCT276 165 648234684 BCT277 156 650726302 BCT278 115 650469051 BCT279 132 644545531 BCT28 70216 637979478 BCT280 141 649814442 BCT281 134 649450402 BCT282 191 660417177 BCT283 367 682809640 BCT284 347 675124360 BCT285 342 634484787 BCT286 967 650630478 BCT287 1062 660858686 BCT288 348 656417489 BCT289 213 648049299 BCT29 351 687282353 BCT290 336 668346549 BCT291 420 659382474 BCT292 222 628005525 BCT293 375 668941888 BCT294 482 642149031 BCT295 260 641727472 BCT296 454 627797034 BCT297 356 634219117 BCT298 353 684270303 BCT299 319 678385665 BCT3 381 727537305 BCT30 383 668855355 BCT300 401 667497920 BCT301 396 661039545 BCT302 463 663906527 BCT303 330 634632688 BCT304 305 688712029 BCT305 348 649077921 BCT306 405 726454392 BCT307 517 622410083 BCT308 494 661284149 BCT309 455 659916418 BCT31 549 676227662 BCT310 516 616219652 BCT311 296 632917363 BCT312 444 628777796 BCT313 276 628970157 BCT314 214 643477467 BCT315 307 627122825 BCT316 360 633977991 BCT317 375 640166759 BCT318 414 619284217 BCT319 350 631523872 BCT32 349 669511233 BCT320 331 637690003 BCT321 442 626504378 BCT322 426 636387223 BCT323 384 658419933 BCT324 301 805593366 BCT325 692 844966935 BCT326 470 660806452 BCT327 385 658476708 BCT328 321 665877614 BCT329 350 653934028 BCT33 419 671821727 BCT330 300 624197186 BCT331 401 637761104 BCT332 338 657346186 BCT333 471 633230800 BCT334 331 648714043 BCT335 323 673527600 BCT336 334 654698197 BCT337 364 660931983 BCT338 295 648554460 BCT339 372 663957713 BCT34 381 678817361 BCT340 442 814594280 BCT341 331 656553506 BCT342 339 648602432 BCT343 379 640043374 BCT344 368 637938552 BCT345 367 652621422 BCT346 356 655324998 BCT347 165 618466958 BCT348 313 630459737 BCT349 433 670615154 BCT35 343 688509055 BCT350 339 632991784 BCT351 334 646759207 BCT352 476 626033377 BCT353 383 659336359 BCT354 493 656879049 BCT355 514 669294359 BCT356 455 665043768 BCT357 348 646602318 BCT358 517 613819992 BCT359 436 623983499 BCT36 441 690396895 BCT360 357 627203091 BCT361 337 638740787 BCT362 118 619770922 BCT363 72 646816165 BCT364 143 697704320 BCT365 356 690815545 BCT366 461 642783509 BCT367 276 634050115 BCT368 276 619374808 BCT369 331 646558342 BCT37 529 714745428 BCT370 334 602089224 BCT371 362 597905626 BCT372 392 598502396 BCT373 356 601238547 BCT374 416 606915275 BCT375 281 625363316 BCT376 344 628992385 BCT377 230 639535331 BCT378 402 632595923 BCT379 324 651011092 BCT38 610 679542909 BCT380 349 656366156 BCT381 379 908853188 BCT382 343 621279997 BCT383 330 639874678 BCT384 307 645540623 BCT385 295 654239854 BCT386 588 649953034 BCT387 297 731328356 BCT388 329 826829678 BCT389 277 633457086 BCT39 325 680496180 BCT390 543 605390581 BCT391 574 607352623 BCT392 548 609451716 BCT393 481 627963513 BCT394 292 611173513 BCT395 335 629715846 BCT396 316 649824977 BCT397 285 598922234 BCT398 319 614968406 BCT399 315 627121517 BCT4 487 736006867 BCT40 250 666843230 BCT400 387 647416444 BCT401 384 627401474 BCT402 300 638343650 BCT403 417 709461831 BCT404 391 666993519 BCT405 337 639071295 BCT406 558 717323664 BCT407 343 723524978 BCT408 374 704902031 BCT409 253 617832355 BCT41 136 635931584 BCT410 245 672131301 BCT411 298 652617762 BCT412 376 611685739 BCT413 293 693182742 BCT414 634 631163800 BCT415 641 622623611 BCT416 401 676464901 BCT417 285 675678853 BCT418 300 627586586 BCT419 836 1030627496 BCT42 283 676588830 BCT420 320 657988851 BCT421 276 622742572 BCT422 940 715296047 BCT423 374 624334947 BCT424 354 698551083 BCT425 307 613936739 BCT426 395 599465935 BCT427 412 646080836 BCT428 229 624178730 BCT429 371 615406492 BCT43 289 701896525 BCT430 428 717602238 BCT431 395 665417844 BCT432 453 719729032 BCT433 415 699950274 BCT434 417 855131949 BCT435 343 650859451 BCT436 363 660064652 BCT437 296 700451519 BCT438 453 660985502 BCT439 292 627313100 BCT44 274 694634931 BCT440 258 608464712 BCT441 336 605626372 BCT442 447 641507624 BCT443 394 628241828 BCT444 306 642572746 BCT445 269 664613581 BCT446 100 613975091 BCT447 97 622044876 BCT448 106 617869460 BCT449 332 753946450 BCT45 264 693184614 BCT450 264 621123461 BCT451 302 646386501 BCT452 309 683196036 BCT453 335 801660811 BCT454 400 651403421 BCT455 376 638442785 BCT456 343 622216203 BCT457 290 687305631 BCT458 229 611531506 BCT459 216 644899672 BCT46 328 699115501 BCT460 541 608668009 BCT461 884 628946792 BCT462 151 606730258 BCT463 191 720700317 BCT464 275 781698571 BCT465 413 639656314 BCT466 260193 514635783 BCT467 16138 626044943 BCT468 119912 627825624 BCT469 198278 562272826 BCT47 333 669707732 BCT470 432028 464121337 BCT471 317011 556898595 BCT472 17735 773864602 BCT473 2981 722022182 BCT474 193 666562655 BCT475 2827 751116924 BCT476 1518 875185356 BCT477 4529 825856779 BCT478 1202 1174280393 BCT479 2367 710956051 BCT48 405 669815108 BCT480 4754 722069367 BCT481 1132 746422464 BCT482 5476 822683810 BCT483 137575 734469723 BCT484 321549 590611309 BCT485 297519 688106302 BCT486 120828 771997064 BCT487 568 617704338 BCT488 535 615787499 BCT489 609 617970572 BCT49 360 672356223 BCT490 756 648227529 BCT491 1703 828334376 BCT492 944 717586038 BCT493 760 1119569040 BCT494 805 1180346897 BCT495 765 1176132439 BCT496 822 1172339942 BCT497 1488 1118220805 BCT498 352 850869475 BCT499 1498 765443805 BCT5 540 726533704 BCT50 233 670597240 BCT500 250 1110342383 BCT501 1330 1076436909 BCT502 55635 988445845 BCT503 242934 458992016 BCT51 293 670504395 BCT52 248 670693411 BCT53 269 668654556 BCT54 350 675363237 BCT55 311 671276920 BCT56 311 683813307 BCT57 401 658146485 BCT58 254 655071485 BCT59 375 664759872 BCT6 429 682177364 BCT60 398 660944850 BCT61 337 666355958 BCT62 367 675574993 BCT63 320 678873342 BCT64 304 672400205 BCT65 409 667330911 BCT66 268 665813132 BCT67 353 680740750 BCT68 338 687403436 BCT69 298 671827103 BCT7 485 666835663 BCT70 354 667124638 BCT71 406 681477446 BCT72 330 656804253 BCT73 332 678496016 BCT74 350 710147982 BCT75 332 669083645 BCT76 352 672613702 BCT77 408 705006549 BCT78 337 658359527 BCT79 313 698556821 BCT8 361 689856462 BCT80 304 677693166 BCT81 311 689190120 BCT82 314 673291477 BCT83 297 811635217 BCT84 577 728915959 BCT85 367 660806661 BCT86 274 697124274 BCT87 281 666543002 BCT88 335 731104729 BCT89 314 677451904 BCT9 301 694805227 BCT90 304 705160504 BCT91 300 772554320 BCT92 345 684747299 BCT93 358 819703832 BCT94 328 675389537 BCT95 297 696564578 BCT96 285 652993363 BCT97 370 693711145 BCT98 300 677361933 BCT99 302 681010844 ENV1 297630 545058822 ENV10 716740 283610129 ENV11 561512 384946150 ENV12 545744 417506161 ENV13 551511 392510982 ENV14 444419 325347776 ENV15 531085 394676817 ENV16 530881 382171847 ENV17 521643 337753585 ENV18 635862 272126120 ENV19 673363 277082562 ENV2 107714 704648808 ENV20 573233 329911372 ENV21 507337 435140644 ENV22 640610 323219164 ENV23 279732 583172439 ENV24 244794 571709956 ENV25 187849 877695999 ENV26 841 1170058558 ENV27 560 1180550806 ENV28 1303 1179768035 ENV29 2700 1151662344 ENV3 270 661070761 ENV30 2624 898495064 ENV31 962 1178603493 ENV32 334 1183235915 ENV33 325 1179255994 ENV34 326 1182933648 ENV35 284 1181111035 ENV36 380 1181878313 ENV37 324 1182786479 ENV38 14608 1149065621 ENV39 6146 1121235176 ENV4 264 674202522 ENV40 110867 970863924 ENV41 48305 162134948 ENV5 363 699956096 ENV6 418 665434873 ENV7 553543 424376903 ENV8 568829 423747374 ENV9 566742 414879274 EST1 465977 174308554 EST10 482090 206002544 EST100 516889 306865331 EST101 571328 238222009 EST102 559344 266245817 EST103 439942 279243831 EST104 452002 282757583 EST105 457955 286410307 EST106 452336 314766838 EST107 467442 317107125 EST108 406804 276529825 EST109 450170 300288384 EST11 471674 197473197 EST110 443481 265864145 EST111 432097 270691488 EST112 464973 262173223 EST113 348437 221439729 EST114 474799 240885432 EST115 484409 272728562 EST116 397603 255054569 EST117 481287 288614511 EST118 386644 256032714 EST119 365465 210483740 EST12 322651 106805205 EST120 442584 106234649 EST121 653825 336061019 EST122 450720 270061335 EST123 519478 280504317 EST124 592160 298028594 EST125 517090 310277473 EST126 512460 330781907 EST127 491369 336189295 EST128 530047 311326609 EST129 558814 332812597 EST13 301748 92376068 EST130 597007 377053172 EST131 585172 426981075 EST132 519350 264230956 EST133 450841 55719858 EST134 437526 139312695 EST135 494344 302270203 EST136 424589 297260608 EST137 464824 306977474 EST138 479576 183769875 EST139 443553 283484375 EST14 347294 166968762 EST140 482149 308093212 EST141 422763 267051765 EST142 474090 271538611 EST143 422259 265721101 EST144 302294 200379319 EST145 390398 242578956 EST146 466797 262924888 EST147 471678 274445172 EST148 478601 303974195 EST149 543465 326298844 EST15 494089 244977013 EST150 408241 270990232 EST151 552336 236522152 EST152 549731 276641841 EST153 556035 339697659 EST154 545656 302778822 EST155 602251 358676156 EST156 550107 330673632 EST157 466868 299086336 EST158 466906 248275161 EST159 490919 283691251 EST16 473914 251466581 EST160 521587 330848048 EST161 528704 337415983 EST162 693859 313670878 EST163 535631 271882550 EST164 182344 69839535 EST17 457741 255238261 EST18 450198 229853923 EST19 474213 243679043 EST2 491819 192418565 EST20 456214 290535489 EST21 490014 267314366 EST22 438150 247225387 EST23 475067 272532526 EST24 581212 324621426 EST25 474780 257607955 EST26 435816 254830520 EST27 459699 251203902 EST28 612464 324541480 EST29 477569 252805350 EST3 502234 208188004 EST30 458365 254279184 EST31 440760 288212290 EST32 407501 291478140 EST33 506243 301774009 EST34 646406 372127418 EST35 492846 313627272 EST36 399111 228697192 EST37 251826 94148588 EST38 250653 102525374 EST39 326766 158121268 EST4 481131 204967959 EST40 458669 260586620 EST41 481754 267308842 EST42 445841 239449401 EST43 477816 281952509 EST44 514761 258511948 EST45 431980 256047374 EST46 555863 284754944 EST47 428486 244611811 EST48 427989 248704600 EST49 356426 171202990 EST5 553084 304440497 EST50 380260 161073616 EST51 497866 268894693 EST52 567492 320893867 EST53 424893 286352052 EST54 443968 244386117 EST55 479786 282558626 EST56 435754 238169901 EST57 475496 267192753 EST58 456986 277433438 EST59 423381 247669185 EST6 554187 330663107 EST60 493638 328088835 EST61 453284 279917347 EST62 446352 228431429 EST63 441591 272849930 EST64 430821 276042787 EST65 387220 256329250 EST66 498995 272535475 EST67 492324 275450362 EST68 504843 275469382 EST69 546221 305143758 EST7 540040 306848614 EST70 553879 334640147 EST71 537036 343435207 EST72 571920 313022094 EST73 457710 272050993 EST74 456120 315244392 EST75 436886 293219109 EST76 478375 283281470 EST77 381772 266692409 EST78 394392 275470637 EST79 386507 267643393 EST8 444578 136330652 EST80 406103 313112130 EST81 481690 303074712 EST82 444238 320683457 EST83 527506 302446605 EST84 595548 185212295 EST85 484418 324599027 EST86 500747 320094415 EST87 513808 307329576 EST88 665955 325351212 EST89 573390 244913561 EST9 610631 285481724 EST90 501739 317302608 EST91 506501 298241394 EST92 557333 188202727 EST93 522639 322569433 EST94 436322 248620121 EST95 562394 196236941 EST96 541446 243629553 EST97 565650 214415004 EST98 479360 290964037 EST99 494248 315531301 GSS1 483478 349296030 GSS10 549397 306199190 GSS11 509424 310377763 GSS12 538965 349861809 GSS13 509956 374561945 GSS14 512829 347180256 GSS15 616177 341878197 GSS16 601327 382162780 GSS17 554042 299120638 GSS18 526424 376163854 GSS19 511153 347728758 GSS2 460201 347842236 GSS20 577589 368081588 GSS21 605056 430635523 GSS22 539615 313905457 GSS23 480138 288780817 GSS24 520252 344268658 GSS25 527693 338229363 GSS26 534498 340938239 GSS27 635470 302704995 GSS28 603451 311431435 GSS29 565949 358860358 GSS3 458538 341239652 GSS30 481697 375352626 GSS31 477291 346732952 GSS32 527267 371271026 GSS33 581837 334076987 GSS34 455082 342398977 GSS35 527353 355575472 GSS36 504166 238094364 GSS37 570301 298031046 GSS38 411072 304778812 GSS39 400428 328690107 GSS4 570405 278279797 GSS40 413710 339236139 GSS41 405659 322862457 GSS42 412830 336636379 GSS43 411114 339557899 GSS44 403793 324239973 GSS45 490827 342492786 GSS46 551608 343422866 GSS47 595593 395591293 GSS48 591270 416015542 GSS49 486602 344199781 GSS5 490746 253738527 GSS50 503419 286244983 GSS51 552099 374136030 GSS52 552299 333535064 GSS53 525030 392321305 GSS54 618666 368575862 GSS55 485099 336857709 GSS56 450841 409348415 GSS57 450273 353330173 GSS58 541079 372435657 GSS59 549525 336334081 GSS6 467594 255861593 GSS60 602681 386165463 GSS61 552655 395556079 GSS62 478610 403882950 GSS63 483387 432402823 GSS64 501034 387499188 GSS65 690968 183615586 GSS66 723576 182114592 GSS67 551505 295253156 GSS68 486805 437660020 GSS69 661923 212508753 GSS7 387194 193364516 GSS70 500655 270169251 GSS71 466358 369620805 GSS72 556347 396600466 GSS73 517359 302779399 GSS74 536051 328408108 GSS75 575833 417082923 GSS76 591094 423249494 GSS77 615264 295006137 GSS78 576832 441018619 GSS79 229487 113442224 GSS8 446631 219820510 GSS9 493290 281335054 HTC1 105590 213533747 HTC2 401600 390675443 HTC3 144375 137060978 HTG1 11398 1117560132 HTG10 6350 1134106153 HTG11 7062 1123865166 HTG12 7026 1130939026 HTG13 7013 1154694359 HTG14 7057 1150125682 HTG15 6831 1156870599 HTG16 6287 1141547857 HTG17 6819 1143695002 HTG18 8686 1144543963 HTG19 9215 1092227754 HTG2 7566 1119083438 HTG20 9512 1082832923 HTG21 8342 1123201930 HTG22 7079 1136335249 HTG23 6609 1155598595 HTG24 7648 1153326826 HTG25 4369 486232722 HTG3 5928 1131528069 HTG4 5455 1141252380 HTG5 5356 1144862828 HTG6 5358 1145015310 HTG7 6607 1133078642 HTG8 6863 1144292626 HTG9 6252 1140248232 INV1 273615 650891779 INV10 14 1136271455 INV100 60 1172045275 INV100 16 1159910001 INV100 10 1125198822 INV100 8 1168893861 INV100 10 1181886938 INV100 11 1124349472 INV100 18 1182045821 INV100 66 1168249651 INV100 46 1181676885 INV100 67 1183721606 INV100 61 1183955448 INV101 97 1166656898 INV101 71 1165637419 INV101 71 1168207696 INV101 71 1182625271 INV101 75 1163687121 INV101 41 1173501709 INV101 26 1181951868 INV101 53 1170041755 INV101 84 1181215442 INV101 41 1180714263 INV101 66 1182246249 INV102 53 1174562880 INV102 11 1133060275 INV102 49 1168521872 INV102 30 1137158099 INV102 5 1073216512 INV102 7 1125700450 INV102 10 1171368215 INV102 13 1116949082 INV102 36 1173415295 INV102 63 1165975000 INV102 23 1165675019 INV103 64 1170923933 INV103 29 1183537718 INV103 82 1180889761 INV103 97 1167943813 INV103 78 1152166277 INV103 68 1179891437 INV103 70 1174408505 INV103 32 1182126063 INV103 72 1153442459 INV103 56 1176082413 INV103 27 1180882186 INV104 91 1145377214 INV104 25 1182192511 INV104 27 1173235919 INV104 24 1047497091 INV104 6 1106587239 INV104 8 1117361023 INV104 12 1171290804 INV104 36 1102536301 INV104 13 1175411375 INV104 30 1083854392 INV104 9 1122302021 INV105 40 1154869018 INV105 55 1173221599 INV105 85 1178914939 INV105 73 1111689335 INV105 50 1182044607 INV105 106 1181002823 INV105 59 1164542291 INV105 45 1169990564 INV105 47 1179405720 INV105 43 1155758692 INV105 106 1180823431 INV106 73 1182592528 INV106 54 1171566111 INV106 111 1176894994 INV106 73 1166612940 INV106 50 1080885215 INV106 10 1175050510 INV106 42 1179692812 INV106 63 1165420798 INV106 41 1153311225 INV106 45 1173095322 INV106 33 1181128159 INV107 71 1183671824 INV107 16 1124647059 INV107 12 1180275535 INV107 16 1125868519 INV107 71 1105939097 INV107 56 1182078446 INV107 6 1048348947 INV107 11 1112847074 INV107 23 1180169940 INV107 96 1175189594 INV107 69 1177765537 INV108 64 1158155870 INV108 49 1172708448 INV108 50 1179891960 INV108 68 1180478550 INV108 67 1165816759 INV108 69 1177399551 INV108 84 1170778360 INV108 74 1171194616 INV108 93 1175862292 INV108 15 258557877 INV108 1 1293457734 INV109 44 1175106968 INV109 1 1291298704 INV109 1 1179439348 INV109 1 1160478065 INV109 1 992416756 INV109 1 914908903 INV109 1 861557771 INV109 14 1170637745 INV109 70 1179993066 INV109 65 1180400965 INV109 68 1180582022 INV11 66 1039127279 INV110 68 1178260106 INV110 61 1167260307 INV110 47 1168264666 INV110 43 957334016 INV110 5 998238218 INV110 7 1162124634 INV110 26 1171141546 INV110 71 1172536328 INV110 43 1132527409 INV110 14 1107342459 INV110 4 1176433905 INV111 775 1176861864 INV111 4 1040449989 INV111 6 1181496301 INV111 255 1177548900 INV111 73 1169539680 INV111 77 1155892558 INV111 39 1153390091 INV111 20 1120353990 INV111 5 1116536280 INV111 6 1066914655 INV111 21 1153608646 INV112 64 1146049765 INV112 15 998564496 INV112 4 988001525 INV112 5 1081838651 INV112 6 1117395520 INV112 72 1182999170 INV112 10 1169370837 INV112 40 1179546201 INV112 53 1178559978 INV112 81 1163709232 INV112 54 1165543577 INV113 26 1180204519 INV113 71 1164847361 INV113 66 1180427351 INV113 20 1114405261 INV113 10 1156831509 INV113 15 1162004988 INV113 57 1182128413 INV113 51 1153077799 INV113 24 1096590343 INV113 5 1163469741 INV113 9 1119080880 INV114 22400 1010615858 INV114 14 1150018780 INV114 137 1178637528 INV114 51 1173088976 INV114 11 1183110201 INV114 11 1117753787 INV114 10 1072671146 INV114 5 1056286122 INV114 40 1175933555 INV114 81 1177754167 INV114 59 1177719070 INV115 404026 292790413 INV115 63 1153651510 INV115 56 1150399967 INV115 43 1165976398 INV115 27 1007471769 INV115 6 1175718880 INV115 7 1102063514 INV115 51 1169713973 INV115 10 1128131747 INV115 6 1157505316 INV115 34 1161696035 INV116 444202 314943745 INV116 36 1112331387 INV116 26 1180727436 INV116 88 1182147002 INV116 101 1181328178 INV116 46 1086696951 INV116 42 1164711952 INV116 48 1163490615 INV116 66 1182413025 INV116 32 1105214604 INV116 20 1180999003 INV117 449309 365567330 INV117 58 1180357340 INV117 51 1157604163 INV117 47 1181367200 INV117 80 1163729876 INV117 48 1181653551 INV117 14 777795464 INV117 3 1132529667 INV117 5 1020474505 INV117 10 1168589990 INV117 44 1168131443 INV118 421337 401034088 INV118 22 1170806605 INV118 26 1154349099 INV118 8 1067441180 INV118 11 1125448204 INV118 17 1176503653 INV118 21 1179864820 INV118 17 1147226502 INV118 15 1094932193 INV118 9 1179284571 INV118 10 1114668210 INV119 246846 674332123 INV119 8 1149559573 INV119 12 1133299713 INV119 50 1176332373 INV119 31 937502882 INV119 4 980919985 INV119 5 1137519087 INV119 5 1013925760 INV119 5 904893845 INV119 7 1162526397 INV119 20 1131303307 INV12 933 1178375804 INV120 320457 922211100 INV120 4 1120469133 INV120 8 1167642987 INV120 22 1161995122 INV120 29 1172007080 INV120 78 1156217896 INV120 26 1182776393 INV120 96 1183229483 INV120 50 1180948030 INV120 42 1178359960 INV120 72 1170962823 INV121 191478 995802831 INV121 75 1172185464 INV121 37 1167070752 INV121 15 1141317378 INV121 61 1181795182 INV121 75 1163049900 INV121 57 1180661991 INV121 87 1176953114 INV121 56 1176740351 INV121 43 1177931199 INV121 44 1175977274 INV122 189712 1023887049 INV122 15 1166515991 INV122 39 1180738993 INV122 26 1171801341 INV122 21 1181923828 INV122 44 1181879300 INV122 51 1154559013 INV122 283 1176295854 INV122 11 1116639045 INV122 18 1183416913 INV122 54 1057151141 INV123 315113 948284702 INV123 3 965515647 INV123 4 987041448 INV123 5 1116901658 INV123 6 1172022049 INV123 7 1105376897 INV123 7 1147429448 INV123 24 1170420503 INV123 64 1176357705 INV123 66 1178239852 INV123 69 1174273991 INV124 420142 881000500 INV124 41 1152072388 INV124 48 1176858592 INV124 23 1120681701 INV124 10 958121404 INV124 2 1113823995 INV124 2 1083730069 INV124 2 981069696 INV124 2 933486884 INV124 3 1144026649 INV124 1 715686243 INV125 261575 879446883 INV125 19 1169956291 INV125 64 1183268994 INV125 102 1179919515 INV125 49 1163819803 INV125 73 1172528031 INV125 11 1092091770 INV125 7 1109536810 INV125 21 1143978763 INV125 38 1181134240 INV125 22 1134428635 INV126 561393 796840837 INV126 396 1176811114 INV126 97 1171031767 INV126 64 1170462638 INV126 39 1148901830 INV126 50 1182346861 INV126 17 1142752485 INV126 48 1136399091 INV126 90 1128363014 INV126 26 1121403460 INV126 8 1139867544 INV127 224150 1003017292 INV127 41 1165675730 INV127 44 1171230957 INV127 57 1155429487 INV127 33 1132294652 INV127 54 1183106017 INV127 72 1183688397 INV127 57 1179778441 INV127 95 1182814743 INV127 60 1181635477 INV127 55 1178306964 INV128 130451 1050230708 INV128 51 1183123419 INV128 10 1080110743 INV128 17 1161940345 INV128 17 1163354238 INV128 8 1084983958 INV128 4 1161620295 INV128 6 1118058588 INV128 239 1155444393 INV128 65 1155292851 INV128 49 1157204977 INV129 197041 1018011764 INV129 18 1121979887 INV129 66 1131525793 INV129 36 1171346633 INV129 64 1173798416 INV129 68 1176010127 INV129 68 1161391857 INV129 28 1131215670 INV129 14 1104510701 INV129 38 1053866510 INV129 4 995617726 INV13 61 1128694635 INV130 626093 748173691 INV130 7 998800688 INV130 47 1180433726 INV130 55 1165086779 INV130 37 1168338411 INV130 24 951415212 INV130 6 967444533 INV130 4 1019718567 INV130 50 1147750232 INV130 16 1180038444 INV130 16 1166973935 INV131 276225 685956404 INV131 13 923912483 INV131 2 896508107 INV131 3 1034986145 INV131 20 1183506423 INV131 23 1091355886 INV131 16 1152556104 INV131 68 1161511031 INV131 43 1175564770 INV131 24 1181907895 INV131 29 1182679156 INV132 286740 109439413 INV132 71 1175511853 INV132 25 1153527608 INV132 35 1138385781 INV132 13 1119745285 INV132 24 1177079527 INV132 29 1163333960 INV132 29 1149221295 INV132 28 1139313110 INV132 41 1180138506 INV132 70 1175797884 INV133 296922 141030754 INV133 77 1161572335 INV133 14 1161070012 INV133 11 1148441084 INV133 34 1168350251 INV133 59 1150051963 INV133 19 1181495898 INV133 47 1167792354 INV133 35 1165489474 INV133 85 1182889472 INV133 41 1129567245 INV134 422849 376698190 INV134 38 1178561172 INV134 53 1110334871 INV134 12 1134757817 INV134 37 1176562891 INV134 56 1150851033 INV134 43 1174859805 INV134 45 1182079147 INV134 15 1150585171 INV134 70 1175963633 INV134 55 1159102669 INV135 266523 668855358 INV135 75 1160168271 INV135 51 1175016127 INV135 76 1183488166 INV135 56 1179454034 INV135 44 1176224766 INV135 47 1180220606 INV135 35 906097906 INV135 5 1089098998 INV135 64 1132211008 INV135 32 1174947293 INV136 27 1037262107 INV136 64 1161190606 INV136 46 1165554000 INV136 32 1155418860 INV136 27 1177850322 INV136 32 1154876249 INV136 40 1180407180 INV136 72 1181094613 INV136 41 1167585606 INV136 8 1154909614 INV136 34 1180304825 INV137 5 1101004500 INV137 50 1169304540 INV137 57 1178377000 INV137 9 1150140427 INV137 15 1171189234 INV137 19 1155543188 INV137 33 1159278043 INV137 45 1177880636 INV137 44 1166240133 INV137 71 1183167713 INV137 88 1172490189 INV138 9 1181454818 INV138 49 1164927459 INV138 22 1132251354 INV138 13 1129894214 INV138 44 1163686024 INV138 26 1183981092 INV138 41 1179923898 INV138 36 907808232 INV138 29 1181218268 INV138 74 1182227852 INV138 74 1102537852 INV139 67 1129228890 INV139 15 1178348273 INV139 50 1165048658 INV139 43 1161831595 INV139 45 1171337050 INV139 54 1178889087 INV139 42 1169567600 INV139 50 1163586271 INV139 38 1182947569 INV139 111 1137377706 INV139 32 1143927652 INV14 62 1131268341 INV140 847 1146199402 INV140 14 1174991217 INV140 10 1144371777 INV140 56 1167262059 INV140 72 1155287473 INV140 26 937485410 INV140 13 1179873298 INV140 56 1149979528 INV140 38 1177616332 INV140 49 1167057001 INV140 29 1174391870 INV141 64 1181892849 INV141 68 1117595055 INV141 10 1169718101 INV141 12 1133108869 INV141 26 1134267683 INV141 75 1173725829 INV141 80 923336198 INV141 3 1053040817 INV141 20 1174162183 INV141 39 1167045253 INV141 46 1182843307 INV142 26 1137518548 INV142 50 1168697143 INV142 90 1177447580 INV142 30 1180973220 INV142 5 1092385473 INV142 15 1181273711 INV142 36 1141610472 INV142 32 1151906756 INV142 60 1176208589 INV142 52 1172079867 INV142 57 1136907188 INV143 907 1171565747 INV143 37 1178410522 INV143 49 1176935478 INV143 58 1183912806 INV143 54 1179193298 INV143 35 1175135492 INV143 12 1146838515 INV143 14 1155822815 INV143 9 1125195925 INV143 24 1131259294 INV143 14 1174429213 INV144 73 1173269478 INV144 64 953702156 INV144 9 1138547731 INV144 11 1163057025 INV144 44 1176118410 INV144 61 1177272092 INV144 38 1151704078 INV144 23 1037982503 INV144 7 1119135050 INV144 18 1164145396 INV144 26 1169410099 INV145 76 1178521265 INV145 22 1168588852 INV145 9 1075663348 INV145 12 1127301685 INV145 17 1156040952 INV145 9 1037437570 INV145 13 1172326463 INV145 23 1169241702 INV145 61 1176786410 INV145 30 1152401873 INV145 13 1130641395 INV146 50 1169114549 INV146 33 1177186019 INV146 62 1170271741 INV146 48 1179839688 INV146 35 1111649581 INV146 36 1169434032 INV146 40 1176360264 INV146 37 1166206484 INV146 30 1176487785 INV146 28 1177536697 INV146 31 1162584273 INV147 53 1168852142 INV147 6 1130174932 INV147 6 1026703645 INV147 4 983577148 INV147 5 1039896888 INV147 5 1061101727 INV147 6 1128653438 INV147 12 1132430497 INV147 16 1183982342 INV147 11 1147348884 INV147 8 1035053358 INV148 80 1175964580 INV148 9 1138594919 INV148 12 1156180599 INV148 10 1092677359 INV148 10 1088671694 INV148 12 1161598953 INV148 44 1134996369 INV148 14 1079116671 INV148 9 1111871949 INV148 7 1178323190 INV148 10 1169783688 INV149 57 1150613334 INV149 47 1173921701 INV149 31 1012488011 INV149 6 1152782616 INV149 9 1071992763 INV149 7 970018966 INV149 6 986164879 INV149 3 1039765747 INV149 4 1036331013 INV149 5 1080302359 INV149 6 1067987662 INV15 73 1174963825 INV150 36 1167025011 INV150 5 1073909196 INV150 4 1047337945 INV150 26 1155208950 INV150 22 1105405485 INV150 9 1100832634 INV150 23 1173284484 INV150 43 746461745 INV150 3 1036951722 INV150 6 1175642338 INV150 87 1179121272 INV151 50 1130276550 INV151 20 1117915946 INV151 10 1156728164 INV151 40 1173311925 INV151 13 1052484257 INV151 10 1156984470 INV151 20 1169667323 INV151 40 1054032921 INV151 8 1129431470 INV151 150 1140186571 INV151 18 1119422511 INV152 25 1161620980 INV152 2 1088695888 INV152 2 954279726 INV152 2 899655310 INV152 3 681586511 INV152 2 1010290375 INV152 2 956517273 INV152 2 852483235 INV152 5 1154000351 INV152 14 1177380507 INV152 5 1029760561 INV153 31 1104632604 INV153 8 1077160140 INV153 11 1149922006 INV153 28 1129228682 INV153 9 1127119764 INV153 7 1106842868 INV153 5 1173270638 INV153 13 1156344884 INV153 45 1151481641 INV153 29 1096098176 INV153 3 1059293851 INV154 45 1164547031 INV154 4 1112205957 INV154 3 1076707575 INV154 43 1176549635 INV154 98 1181821965 INV154 26 1073674733 INV154 11 1168975743 INV154 22 1150586260 INV154 23 1165885360 INV154 23 843961488 INV154 3 931513797 INV155 64 1154245848 INV155 30 1078540764 INV155 20 1170006908 INV155 35 1167858067 INV155 23 1149648485 INV155 10 1071181829 INV155 9 1149983304 INV155 23 1116665399 INV155 39 1087703058 INV155 41 1182040183 INV155 36 944018716 INV156 29 1132564402 INV156 8 1155515749 INV156 25 1182319718 INV156 61 1176870909 INV156 55 1054928623 INV156 9 1090445781 INV156 11 1123548494 INV156 21 1096322499 INV156 31 1060128720 INV156 9 1157548004 INV156 34 1178620354 INV157 8 1084492301 INV157 53 999428376 INV157 5 1109693485 INV157 17 1173227967 INV157 83 1181027561 INV157 41 1183327794 INV157 62 1176842544 INV157 68 1176400809 INV157 52 1180281886 INV157 44 1170665316 INV157 29 1138022285 INV158 70 1175427825 INV158 61 1178164693 INV158 55 1166770664 INV158 63 1161811086 INV158 24 1151219405 INV158 22 1140842997 INV158 16 1160132170 INV158 58 1166892020 INV158 22 1107712294 INV158 29 1179515017 INV158 37 1036291081 INV159 61 1173375724 INV159 8 1140537977 INV159 19 1164929874 INV159 11 956981382 INV159 6 1053280334 INV159 4 1175407494 INV159 79 1171824453 INV159 49 1174668215 INV159 50 1087115790 INV159 9 1124917685 INV159 36 1181885425 INV16 12297 1156978897 INV160 51 1181192230 INV160 33 1177461549 INV160 58 1176942123 INV160 60 1170169860 INV160 35 1166575257 INV160 57 1176326036 INV160 59 1181114180 INV160 41 1161460041 INV160 31 1163193158 INV160 49 1175658397 INV160 73 1183554127 INV161 69 1183806686 INV161 17 1016034645 INV161 16 1174885688 INV161 58 1142473153 INV161 32 708086325 INV161 1 1334148782 INV161 1 1045664434 INV161 1 750186070 INV161 2 1065650976 INV161 2 921404803 INV161 6 1134176058 INV162 129 1178189110 INV162 22 1079229813 INV162 14 1181135720 INV162 69 1183688986 INV162 8 1168571668 INV162 74 1180695666 INV162 32 1148423947 INV162 6 1041196370 INV162 11 1170279677 INV162 70 1177762993 INV162 82 1172119986 INV163 350 1164764451 INV163 30 1098714689 INV163 19 1174428707 INV163 45 1061192070 INV163 9 1091382702 INV163 11 1139424092 INV163 21 1169571369 INV163 38 1133845884 INV163 65 1178998809 INV163 50 1178906181 INV163 50 1156603038 INV164 79 1177852253 INV164 17 1171570258 INV164 13 1099289144 INV164 14 1154631920 INV164 6 1089568060 INV164 7 1109283417 INV164 10 1155707076 INV164 11 1023361543 INV164 7 1168745475 INV164 37 1175737964 INV164 50 1158808587 INV165 67 1172820533 INV165 24 1040532501 INV165 8 1076896237 INV165 17 1183949918 INV165 51 1073899198 INV165 18 1158648766 INV165 16 1162383471 INV165 19 1174374831 INV165 53 1136269814 INV165 45 1174240990 INV165 51 1147696678 INV166 68 1167446879 INV166 17 1183444596 INV166 68 1180152655 INV166 37 1150054992 INV166 69 1171710650 INV166 41 1029711464 INV166 65 1163256919 INV166 46 1179742489 INV166 34 1030718501 INV166 57 1175299622 INV166 9 1113257017 INV167 31 1158588788 INV167 12 1128588324 INV167 11 922358814 INV167 10 1171514245 INV167 34 1173665984 INV167 88 1141861279 INV167 73 1182415527 INV167 28 1124896066 INV167 31 1145542933 INV167 16 1158130447 INV167 48 1180894050 INV168 12 1151058946 INV168 65 1173640833 INV168 59 1148458961 INV168 28 1163957752 INV168 45 1175299522 INV168 90 1180514007 INV168 77 1157438150 INV168 41 1177340741 INV168 52 1175061311 INV168 38 1172949715 INV168 25 1096182939 INV169 30 1101610000 INV169 14 1119260224 INV169 40 1177563651 INV169 45 1171464185 INV169 56 1033825010 INV169 4 1148020062 INV169 52 1163420079 INV169 57 1158534138 INV169 77 1181972401 INV169 43 1172913537 INV169 49 1171860627 INV17 154350 856745696 INV170 51 1166575072 INV170 75 1182999951 INV170 49 968312132 INV170 6 1148188281 INV170 49 1178039472 INV170 25 1143350354 INV170 19 1123688089 INV170 27 1155508206 INV170 59 1181388060 INV170 54 1142841104 INV170 29 1171340700 INV171 55 1180016738 INV171 8 1040436066 INV171 7 1167855427 INV171 12 1165174526 INV171 6 1087613592 INV171 10 1165920741 INV171 46 1181621999 INV171 80 1181535591 INV171 71 1148861234 INV171 30 1053751967 INV171 7 1179544038 INV172 194 1175613203 INV172 59 1170726676 INV172 60 1164883989 INV172 59 1182978312 INV172 66 1181715218 INV172 43 1164426952 INV172 46 1177716417 INV172 21 1177089205 INV172 23 1081239084 INV172 28 1174154895 INV172 105 1183638984 INV173 43 1167512002 INV173 64 1062946896 INV173 10 1065353494 INV173 13 1108077978 INV173 7 1027766864 INV173 40 1177705050 INV173 31 1136460702 INV173 83 1180727957 INV173 56 1148099581 INV173 78 1175864807 INV173 67 1166657043 INV174 37 1028338969 INV174 46 947398395 INV174 4 969609680 INV174 6 1132041108 INV174 37 1183054476 INV174 71 1162398296 INV174 24 1083852253 INV174 9 1155919363 INV174 46 1181328001 INV174 64 1176621539 INV174 28 1075842774 INV175 20 1145496549 INV175 8 1058662581 INV175 28 1182745051 INV175 65 1164811367 INV175 26 1141744052 INV175 22 1126346000 INV175 31 1183808748 INV175 42 1179391926 INV175 70 1055597945 INV175 8 1112290143 INV175 11 1182887684 INV176 31 1131526231 INV176 30 1183257943 INV176 64 1162705873 INV176 12 1125395246 INV176 15 1137123333 INV176 17 971293778 INV176 4 1004473388 INV176 5 1147468853 INV176 5 1047084327 INV176 12 1171963771 INV176 10 560745070 INV177 27 1181566685 INV177 1 852319389 INV177 2 1010646983 INV177 3 1003973449 INV177 7 1133311987 INV177 2 202788595 INV177 9 1173074266 INV177 35 1128302396 INV177 18 1154891204 INV177 13 1123179122 INV177 12 1150498239 INV178 53 1176879731 INV178 51 1171874210 INV178 79 1180771897 INV178 57 1175579947 INV178 61 1180696920 INV178 56 1161553330 INV178 59 1166537391 INV178 77 1181716758 INV178 64 1178376047 INV178 51 1090590918 INV178 15 1180068609 INV179 126 1162742157 INV179 15 1143362463 INV179 51 1171878545 INV179 23 1154855318 INV179 22 1182366693 INV179 18 1157303554 INV179 12 1110845226 INV179 9 1045548821 INV179 2 902781088 INV179 17 1175265006 INV179 31 1115454847 INV18 33 1114687727 INV180 52 1181064839 INV180 66 1183958382 INV180 87 1175251735 INV180 109 1181589779 INV180 60 1173908025 INV180 81 1174134107 INV180 48 1161159425 INV180 53 1155479078 INV180 47 1157518276 INV180 41 1156706273 INV180 42 1172715230 INV181 48 1172177022 INV181 76 1174297055 INV181 71 1172810435 INV181 59 1178183182 INV181 55 1110627888 INV181 21 1154118012 INV181 65 1171866291 INV181 81 1181998349 INV181 85 1177781602 INV181 80 1180721133 INV181 70 1183267279 INV182 42 1132343302 INV182 45 1157916081 INV182 41 1066440390 INV182 12 1084503626 INV182 13 1157170885 INV182 1 1262576529 INV182 1 1177353435 INV182 1 1051502667 INV182 1 1003674298 INV182 1 874086278 INV182 1 775638139 INV183 27 1127132280 INV183 1 696689830 INV183 1 689869291 INV183 2 991847894 INV183 2 483481402 INV183 1 1260571872 INV183 1 1157698655 INV183 1 1046143717 INV183 1 996218388 INV183 1 868557452 INV183 1 766622868 INV184 4 1090646487 INV184 1 690294575 INV184 1 677070179 INV184 2 1005860600 INV184 9 1158992033 INV184 12 1130823060 INV184 22 959627924 INV184 7 1112156906 INV184 50 1153674082 INV184 45 1102250600 INV184 29 1170434035 INV185 21 1181231958 INV185 25 1182963155 INV185 12 1132882348 INV185 29 1125295589 INV185 28 1168183511 INV185 27 1026720370 INV185 8 1091553027 INV185 15 1163911683 INV185 89 1173001868 INV185 83 1172726806 INV185 60 1168173173 INV186 34 1147729809 INV186 63 1167516383 INV186 42 1174834189 INV186 29 1141896239 INV186 307 1181421988 INV186 62 1182404716 INV186 54 1157269684 INV186 25 1177832336 INV186 12 1113240895 INV186 17 1168982346 INV186 57 1181203507 INV187 29 1132516628 INV187 53 1181691213 INV187 6 1082003268 INV187 7 1079867850 INV187 9 1161299035 INV187 11 1120667432 INV187 28 1179458122 INV187 54 1169850596 INV187 32 1154233539 INV187 28 1163432187 INV187 72 1173278498 INV188 23 1096762504 INV188 40 1102498209 INV188 22 1183270006 INV188 93 1174555498 INV188 66 1172729788 INV188 36 720873068 INV188 1 671475784 INV188 3 1112976628 INV188 14 1126646253 INV188 18 1141111948 INV188 55 1179172858 INV189 33 1097341670 INV189 42 1151889566 INV189 31 1173097722 INV189 21 1177303858 INV189 21 1146023132 INV189 48 1175499773 INV189 75 1166862250 INV189 62 1102734864 INV189 37 1180332069 INV189 23 1141942940 INV189 14 1178264547 INV19 146 1115943106 INV190 26 1104254159 INV190 9 1181204827 INV190 70 1180101109 INV190 23 1164311516 INV190 24 1163082511 INV190 71 1177490787 INV190 102 1183539701 INV190 85 1171547907 INV190 57 1155744888 INV190 51 1167527613 INV190 22 1171453450 INV191 7 1091196989 INV191 21 1140072553 INV191 77 1182895713 INV191 32 876927737 INV191 4 1182014695 INV191 4 712378168 INV191 2 1021762753 INV191 3 1058500992 INV191 4 1173742493 INV191 14 1167822869 INV191 25 1182228762 INV192 42 1096571198 INV192 69 1126862236 INV192 31 1157458043 INV192 62 1183566931 INV192 66 1165428806 INV192 51 1166490349 INV192 39 1172841152 INV192 47 1173362896 INV192 40 1165631279 INV192 43 1181356262 INV192 75 1174239092 INV193 91 1176556109 INV193 68 1171377647 INV193 70 1182502359 INV193 65 1117265810 INV193 21 1180668271 INV193 28 1171648994 INV193 16 1109278277 INV193 28 1162240481 INV193 51 1141553331 INV193 54 1169264428 INV193 60 1170186921 INV194 25 1099741141 INV194 42 1117383607 INV194 13 1181036337 INV194 11 1110557201 INV194 16 1169323128 INV194 8 970711557 INV194 5 1073443385 INV194 14 1112496182 INV194 20 1155870277 INV194 13 1110791298 INV194 16 1144046450 INV195 67 1169466543 INV195 12 1033459244 INV195 6 1123969148 INV195 2 803923520 INV195 24 1157883170 INV195 14 1124114191 INV195 47 1176064327 INV195 68 1172750561 INV195 70 1154276942 INV195 38 1053118270 INV195 9 1118577744 INV196 93 1174837497 INV196 41 1175814206 INV196 59 1156503980 INV196 31 1157340613 INV196 20 1125792092 INV196 35 1175959879 INV196 25 1009685761 INV196 13 1126400307 INV196 8 1150081860 INV196 14 1135894880 INV196 44 1163005721 INV197 76 1043547247 INV197 59 1041616489 INV197 37 1147891640 INV197 14 1073137503 INV197 11 1131874637 INV197 161 1174487401 INV197 19 1179469496 INV197 17 1065508153 INV197 4 1132866825 INV197 10 1122379585 INV197 42 1103080576 INV198 5 818528617 INV198 16 1149700016 INV198 26 1075966770 INV198 9 1075930600 INV198 10 1122587981 INV198 191 1176213436 INV198 36 1180445357 INV198 14 1175954723 INV198 17 1138596534 INV198 38 1181692999 INV198 71 1175716045 INV199 14 1180333683 INV199 18 1148128452 INV199 28 1167312821 INV199 49 1168872043 INV199 20 1167156767 INV199 14 1083420700 INV199 20 1170153262 INV199 82 1173277991 INV199 9 1052032002 INV199 7 1128204833 INV199 5 1025727439 INV2 48102 1062553180 INV20 65 1177901473 INV200 42 1142993537 INV200 8 1155018402 INV200 14 1084008401 INV200 5 1089437958 INV200 6 1144646398 INV200 38 1112856519 INV200 16 1162741163 INV200 38 1181469790 INV200 1173 1157681815 INV200 87 1175814885 INV200 22 1175364521 INV201 14 1092645964 INV201 50 1172431933 INV201 17 997746606 INV201 5 1072357372 INV201 58 1165755027 INV201 74 1055442860 INV201 21 1162458373 INV201 54 1115297219 INV201 9 1182574213 INV201 8 1053109042 INV201 9 1183126797 INV202 21 1173752204 INV202 57 1178084649 INV202 86 1181896186 INV202 73 1173222784 INV202 833 1148269828 INV202 16 1135440746 INV202 41 1166600857 INV202 35 1088056415 INV202 17 1174809123 INV202 37 1168181551 INV202 36 1152634659 INV203 114 1070956267 INV203 9 1161561814 INV203 29 1060390752 INV203 16 1133861154 INV203 32 1122233749 INV203 15 1169833541 INV203 5 1169673966 INV203 3 1101654657 INV203 3 952375850 INV203 3 808630417 INV203 1 1871590987 INV204 45 1159531951 INV204 1 1742968730 INV204 1 1717169146 INV204 3 1121989557 INV204 10 1164980829 INV204 32 1141137095 INV204 57 1148198310 INV204 66 1161881209 INV204 53 1175997829 INV204 41 1145432469 INV204 20 1173487730 INV205 29 1155529603 INV205 17 1062957268 INV205 29 1180361787 INV205 62 1177703189 INV205 34 1154653668 INV205 10 1149927373 INV205 16 1091440903 INV205 36 1132431194 INV205 4 1183041100 INV205 5 1183658086 INV205 12 1174121127 INV206 24 1175708013 INV206 16 1137293828 INV206 28 1155344910 INV206 42 1166731958 INV206 69 1175096833 INV206 42 1167574941 INV206 73 1181261057 INV206 51 1067022704 INV206 8 1146997739 INV206 11 1046139534 INV206 3 1011339733 INV207 54 1164357983 INV207 3 933672973 INV207 4 1179362862 INV207 4 1098830492 INV207 4 1016851891 INV207 3 856828085 INV207 33 1170382612 INV207 60 1177384666 INV207 26 1170220244 INV207 22 1182661662 INV207 26 1150545645 INV208 37 1146211608 INV208 36 1004977751 INV208 5 1009238428 INV208 6 1110016442 INV208 9 1135713996 INV208 23 1123217333 INV208 24 1124814630 INV208 19 1175548559 INV208 34 1179782621 INV208 70 1176073173 INV208 63 1156269579 INV209 62 1170494625 INV209 31 1109207500 INV209 42 1172972707 INV209 29 1096475072 INV209 13 1140564712 INV209 36 1103476845 INV209 31 1153466134 INV209 8 1153805380 INV209 13 1181843176 INV209 18 1117862521 INV209 5 1135155801 INV21 74 1168382733 INV210 59 1160570296 INV210 5 1054156959 INV210 6 1116330840 INV210 7 1132953972 INV210 11 1147838078 INV210 82 1183557925 INV210 96 1163764055 INV210 49 1172956721 INV210 34 1095506894 INV210 10 1121672773 INV210 30 1134991518 INV211 49 1119540207 INV211 17 1111549528 INV211 8 1157333043 INV211 13 1115865353 INV211 16 1118869819 INV211 30 1180457334 INV211 52 1145220460 INV211 16 1133018454 INV211 7 338112905 INV211 1 1189782241 INV211 1 1029927947 INV212 28 937171860 INV212 1 728062374 INV212 2 1101213457 INV212 3 1040420143 INV212 4 1023831643 INV212 3 362103279 INV212 1 1054206708 INV212 1 914059835 INV212 2 1030288154 INV212 4 1158566617 INV212 25 1047347997 INV213 6 1088147077 INV213 15 1171331837 INV213 56 1180435178 INV213 11 1164417279 INV213 26 1163628404 INV213 53 1060146443 INV213 45 1174407048 INV213 65 1181610382 INV213 35 1170345451 INV213 62 1178997498 INV213 40 1101011931 INV214 45 1171786882 INV214 5 1148529743 INV214 5 1051337044 INV214 6 1106895686 INV214 8 1144998989 INV214 26 1148790706 INV214 27 1155199664 INV214 24 1181622461 INV214 30 1147207098 INV214 15 1181282975 INV214 40 1161994338 INV215 27 1169342313 INV215 44 1131459754 INV215 14 958295412 INV215 10 1165362821 INV215 15 1116357487 INV215 26 999191722 INV215 7 1056576099 INV215 6 1060499329 INV215 7 1113356293 INV215 8 1070183301 INV215 10 1002500335 INV216 21 1152864707 INV216 5 1018006086 INV216 7 1103334436 INV216 8 1176804866 INV216 14 1180022384 INV216 66 1169306759 INV216 28 1089770126 INV216 59 1148375523 INV216 7 451991680 INV216 1 1105058116 INV216 2 1042692757 INV217 49 1183849062 INV217 3 970180279 INV217 3 866156462 INV217 2 383822756 INV217 1 1002081707 INV217 2 1015944984 INV217 3 1013658784 INV217 3 946664196 INV217 3 1109568744 INV217 1 673546918 INV217 1 617651372 INV218 40 1048433496 INV218 2 1031406910 INV218 8 1175604061 INV218 2 1050934873 INV218 1 834309956 INV218 1 670808488 INV218 1 626387428 INV218 2 1023724433 INV218 8 1140864533 INV218 3 1149664116 INV218 15 1175607975 INV219 6 1159643379 INV219 14 283779322 INV219 1 1226408822 INV219 1 1138932152 INV219 1 1123617317 INV219 1 1071549555 INV219 1 955349656 INV219 1 891279500 INV219 1 889235789 INV219 6 1183328340 INV219 38 1123841736 INV22 11 1112643067 INV220 40 1068441268 INV220 14 1153184934 INV220 8 1110861705 INV220 33 1183158488 INV220 30 1103080204 INV220 17 1171239271 INV220 18 1125461596 INV220 24 1179290847 INV220 45 1168854965 INV220 55 1180423136 INV220 39 1159321262 INV221 32 1098397924 INV221 26 1154073500 INV221 17 1150948784 INV221 46 1172626701 INV221 58 1173201633 INV221 21 1158889108 INV221 12 1181843102 INV221 9 1133645263 INV221 22 1041283397 INV221 12 1178015238 INV221 31 1174348424 INV222 10 1148969811 INV222 18 1133572959 INV222 38 1052645201 INV222 20 1180059426 INV222 36 968076406 INV222 20 1171014226 INV222 15 1086390412 INV222 2 1173155091 INV222 1 1003434937 INV222 1 765756381 INV222 1 733620560 INV223 35 874428405 INV223 1 612179341 INV223 2 1168448425 INV223 4 1029810149 INV223 1 847056348 INV223 1 1274027466 INV223 1 1059153974 INV223 1 776545396 INV223 2 1044222946 INV223 2 846218953 INV223 5 1091774620 INV224 4 1100578165 INV224 31 1139584889 INV224 42 1091337023 INV224 8 948904137 INV224 6 1031498554 INV224 13 1150954263 INV224 12 1134459672 INV224 12 1167437666 INV224 20 1151456693 INV224 28 1156084901 INV224 35 1157715837 INV225 55 1168335732 INV225 42 1141144076 INV225 24 1018671215 INV225 4 1140437578 INV225 4 957437879 INV225 5 1035481967 INV225 23 1164995411 INV225 36 1166914302 INV225 33 1075399771 INV225 4 1120654435 INV225 4 1033804328 INV226 22 1143144722 INV226 5 1084880158 INV226 6 1045040697 INV226 36 1094966341 INV226 16 1169163069 INV226 24 941338584 INV226 8 1089725129 INV226 11 1142405032 INV226 21 1175297852 INV226 23 1038422282 INV226 3 990860162 INV227 19 1176869883 INV227 34 1162414232 INV227 59 1165245569 INV227 55 1180975824 INV227 45 1183852269 INV227 45 1090837749 INV227 19 1182799843 INV227 59 1180207575 INV227 27 1177424938 INV227 13 980663763 INV227 12 1165207943 INV228 32 1114299818 INV228 57 1045545395 INV228 3 1103236782 INV228 22 1179480119 INV228 44 1170244112 INV228 16 936935978 INV228 5 1049513346 INV228 40 1180272662 INV228 66 1179106667 INV228 55 1145321881 INV228 34 1170845904 INV229 29 1179473251 INV229 131 1183095069 INV229 34 1083469900 INV229 7 944499635 INV229 4 1071058349 INV229 14 1158787783 INV229 72 1140327452 INV229 42 1102209041 INV229 35 1168932510 INV229 16 1120424577 INV229 14 1051762353 INV23 13 1166656024 INV230 53 1175591824 INV230 25 1153378155 INV230 20 1168307265 INV230 25 1144950181 INV230 7 979891219 INV230 34046 1119014117 INV230 414678 410031425 INV230 149381 207965410 INV231 78 1181589122 INV232 61 1152404384 INV233 68 1173424702 INV234 68 1132453690 INV235 53 1168637477 INV236 51 1176524972 INV237 8 1140910596 INV238 19 1159858311 INV239 47 1160059583 INV24 14 1157019427 INV240 32 1178589851 INV241 37 1162543023 INV242 34 1143915167 INV243 37 1113749165 INV244 8 1106487269 INV245 62 1109473922 INV246 46 1160167317 INV247 45 1092159181 INV248 34 1175550270 INV249 25 1039772717 INV25 137 1133949848 INV250 73 1125649237 INV251 8 1111428505 INV252 10 1170555672 INV253 30 1089948315 INV254 17 1143250828 INV255 43 1106243903 INV256 67 1084092646 INV257 13 1121987543 INV258 40 1157144248 INV259 132 1168492720 INV26 62 1114730215 INV260 96 1065659809 INV261 11 1081401435 INV262 36 1180919209 INV263 27 1049507042 INV264 21 1182984707 INV265 51 1124696401 INV266 10 1153224711 INV267 17 1183071328 INV268 43 1158744873 INV269 26 1148412488 INV27 18 1061985831 INV270 65 1171256248 INV271 28 1123493494 INV272 13 1138496972 INV273 20 1142945549 INV274 30 1116830819 INV275 56 1017275628 INV276 4 1025266218 INV277 47 1183581792 INV278 23 1141449862 INV279 375 1180236783 INV28 11 1113069507 INV280 96 1139172162 INV281 19 1168497183 INV282 38 1138754106 INV283 17 1166894898 INV284 25 1094539453 INV285 25 1071893119 INV286 26 1091050727 INV287 24 1061687259 INV288 10 1056135378 INV289 16 1070828630 INV29 27 1148865326 INV290 12 1117452242 INV291 14 1123071741 INV292 19 1085845070 INV293 60 1126302065 INV294 11 1142405959 INV295 29 1173978223 INV296 61 1171216006 INV297 27 1176340908 INV298 99 1091785749 INV299 10 1128248621 INV3 177 1180760700 INV30 86 1095486156 INV300 28 1151851000 INV301 38 1156027306 INV302 50 1179318313 INV303 46 1176220893 INV304 86 1126855865 INV305 11 1150190119 INV306 18 1175856240 INV307 34 1180837817 INV308 13 1046470165 INV309 16 1179517444 INV31 269 1145330434 INV310 37 1166090880 INV311 23 1158756635 INV312 60 1148464830 INV313 56 1179257620 INV314 38 1182747184 INV315 26 1144860495 INV316 26 1164099579 INV317 55 1161028152 INV318 35 1180864303 INV319 11 492041846 INV32 86 1175738999 INV320 1 2140038457 INV321 1 1533311695 INV322 1 991394496 INV323 1 709211797 INV324 2 1097626663 INV325 3 1157353054 INV326 5 1139385694 INV327 25 1133784150 INV328 63 1181878340 INV329 101 1158086146 INV33 144 1153189339 INV330 38 1181278882 INV331 286 1183080436 INV332 45 1154854736 INV333 61 1174533348 INV334 32 1008528964 INV335 27 1174263346 INV336 64 1149369266 INV337 26 1183364031 INV338 67 1168339909 INV339 66 1147884150 INV34 69 1131367128 INV340 44 965200748 INV341 8 1166380755 INV342 39 1173103949 INV343 62 1126817827 INV344 64 1170795920 INV345 47 1172322211 INV346 10 1113379081 INV347 14 1164469949 INV348 61 1167552745 INV349 62 1125544552 INV35 8 889788353 INV350 54 1169401059 INV351 31 1176053521 INV352 43 1171176178 INV353 14 1116220489 INV354 17 1150285064 INV355 45 1165961048 INV356 56 1112251606 INV357 15 1164046658 INV358 98 1179269248 INV359 40 1157032737 INV36 4 1008855096 INV360 60 1179722234 INV361 67 1152073239 INV362 80 1180095790 INV363 48 1177743598 INV364 40 1169609794 INV365 49 1167566562 INV366 53 1180763297 INV367 64 1167962091 INV368 52 1179788115 INV369 41 1077008198 INV37 23 1177944900 INV370 8 1143611054 INV371 32 1178180889 INV372 55 1169726953 INV373 30 1143514541 INV374 42 1181985768 INV375 49 1170651243 INV376 60 1177770436 INV377 58 1163899303 INV378 48 1179283094 INV379 51 1009239312 INV38 143 1164009018 INV380 45 1170597051 INV381 33 1149912987 INV382 289 1131447836 INV383 63 1171437391 INV384 76 1168488225 INV385 62 1166044751 INV386 54 1175149356 INV387 44 1155919506 INV388 237 1056358889 INV389 17 1176712065 INV39 57 1125259431 INV390 30 1120655481 INV391 29 1165843079 INV392 39 1171071737 INV393 56 1177442728 INV394 34 1176994701 INV395 49 1167953952 INV396 73 1168533590 INV397 58 1162130134 INV398 35 1173169764 INV399 68 1169176711 INV4 26 1178079121 INV40 24 1170570773 INV400 55 1177852925 INV401 47 1183600727 INV402 48 1181899572 INV403 42 1167995858 INV404 337 1170755978 INV405 38 1163700627 INV406 51 1176507144 INV407 23 1109670578 INV408 10 1151709943 INV409 6 1065246632 INV41 71 1164866290 INV410 292 1180288671 INV411 59 1165848044 INV412 41 1163567748 INV413 12 1044631257 INV414 68 1177050385 INV415 65 1172210463 INV416 49 1161182414 INV417 53 1162135205 INV418 61 1169504490 INV419 53 1178451492 INV42 59 1071474101 INV420 54 1167857969 INV421 41 1157720543 INV422 15 1130065300 INV423 21 1172240161 INV424 23 1179640685 INV425 58 1179007315 INV426 65 1168494135 INV427 15 1170602412 INV428 68 1140944349 INV429 20 1182068121 INV43 4 1033248522 INV430 51 1161151176 INV431 289 1181800355 INV432 58 1183778194 INV433 56 1152524873 INV434 37 1181059764 INV435 33 1183150543 INV436 17 1162895880 INV437 8 1168073996 INV438 16 953821265 INV439 23 1165093501 INV44 5 1102408523 INV440 28 1178140243 INV441 26 1153570909 INV442 57 1183229295 INV443 98 1168775988 INV444 30 1175624374 INV445 48 1183765169 INV446 33 1182834679 INV447 62 1166367683 INV448 39 1159631380 INV449 47 1173723338 INV45 6 1044745170 INV450 29 1179286913 INV451 54 1120407820 INV452 49 1182565343 INV453 44 1173820162 INV454 8 1099778931 INV455 9 1112149363 INV456 6 1182219113 INV457 53 1167128077 INV458 57 1099506648 INV459 48 1183468124 INV46 5 1082205073 INV460 28 1157438427 INV461 264 1160173680 INV462 39 1150347320 INV463 32 1182321740 INV464 60 1180145995 INV465 60 1009480385 INV466 6 1089485995 INV467 7 1094680253 INV468 8 1121227790 INV469 40 1040605372 INV47 6 1157872047 INV470 24 1175286942 INV471 40 1169498334 INV472 69 1169527918 INV473 38 1167718847 INV474 46 1106067541 INV475 76 1181623637 INV476 62 1166674309 INV477 48 1128684741 INV478 7 1073869934 INV479 9 1134446170 INV48 8 1131611572 INV480 29 1155126807 INV481 36 1063228700 INV482 41 1147739941 INV483 35 1174169233 INV484 71 1171166426 INV485 63 1163209472 INV486 36 1170458138 INV487 68 1145964553 INV488 52 1183966324 INV489 68 1156021793 INV49 9 1166811123 INV490 27 1117466149 INV491 33 1174621744 INV492 60 1173659946 INV493 19 1043302169 INV494 17 1163552052 INV495 30 1170798214 INV496 12 1162172113 INV497 7 962266698 INV498 10 1122666348 INV499 38 1175274691 INV5 79 1180204163 INV50 12 1170529743 INV500 36 1161806043 INV501 21 1098367790 INV502 32 1180972952 INV503 61 1182569584 INV504 13 1096698627 INV505 40 1180574963 INV506 43 1166132303 INV507 23 852163924 INV508 2 875798541 INV509 25 1182573411 INV51 5 1140274668 INV510 12 1100891702 INV511 22 1142881286 INV512 9 1085548731 INV513 23 1126059691 INV514 31 1178570313 INV515 29 1169666774 INV516 58 1180250471 INV517 84 1181418412 INV518 89 1176955766 INV519 42 1077018672 INV52 6 1125723435 INV520 14 1096214158 INV521 31 1177728372 INV522 21 1110816208 INV523 11 1093891811 INV524 47 1180653691 INV525 38 1118794013 INV526 32 1182120112 INV527 19 1162792033 INV528 46 1179300933 INV529 77 1169175653 INV53 6 1010603762 INV530 57 1165452560 INV531 56 1169579095 INV532 64 1177003208 INV533 51 1150753527 INV534 44 1181690781 INV535 36 1161544058 INV536 10 995196950 INV537 6 1059833314 INV538 10 1136361044 INV539 87 1174578615 INV54 4 1036851011 INV540 23 1123569485 INV541 8 1175145944 INV542 23 1146981517 INV543 159 1181260338 INV544 22 1176694479 INV545 51 1156761993 INV546 37 1099744599 INV547 25 1172379226 INV548 59 1162280930 INV549 26 1108337100 INV55 5 1047077346 INV550 17 1134093194 INV551 25 1129714994 INV552 72 1011135646 INV553 8 1072050341 INV554 8 1162389588 INV555 128 1171063612 INV556 50 1121058678 INV557 18 1155208681 INV558 5 1160167511 INV559 4 968383396 INV56 5 904855149 INV560 5 1031138611 INV561 8 1131384592 INV562 12 1145389146 INV563 58 1153791878 INV564 22 1157941616 INV565 54 1176691153 INV566 215 1145957398 INV567 51 1158167943 INV568 82 1182754896 INV569 68 1003043540 INV57 4 1094673453 INV570 6 1059330862 INV571 14 1171729753 INV572 42 1182272176 INV573 72 1162111936 INV574 28 1173062497 INV575 12 1142212769 INV576 53 1183400392 INV577 50 1163753634 INV578 36 1182443846 INV579 26 1148157309 INV58 5 1081852177 INV580 13 1173837412 INV581 11 1158241259 INV582 43 1168732588 INV583 63 1169739440 INV584 67 1165752228 INV585 6 1182980772 INV586 8 1183421646 INV587 44 1092961795 INV588 42 1182240670 INV589 24 1181465463 INV59 14 1162530826 INV590 34 1152306552 INV591 32 1170089160 INV592 23 1122688710 INV593 9 1138657726 INV594 11 1111847433 INV595 15 1152004927 INV596 46 1180614356 INV597 31 1181297197 INV598 41 1183650752 INV599 30 1132041424 INV6 176 1135558567 INV60 158043 918567031 INV600 71 904440610 INV601 29 1176846517 INV602 28 747927694 INV603 2 1038048300 INV604 39 1105357037 INV605 23 1173259357 INV606 23 1066628795 INV607 199 1165094299 INV608 18 1183025523 INV609 34 1125184633 INV61 328891 581206310 INV610 20 1144733303 INV611 28 1141591471 INV612 17 1147079755 INV613 38 1178703937 INV614 24 1174992356 INV615 19 1161345054 INV616 10 1165603747 INV617 18 1169040548 INV618 36 951533566 INV619 3 933822636 INV62 96 1172550818 INV620 35 1009815080 INV621 50 1169091726 INV622 40 1119721390 INV623 36 1025608517 INV624 3 1179864860 INV625 52 1165273241 INV626 62 1170837882 INV627 46 1163333630 INV628 52 1150212999 INV629 32 1168689882 INV63 77 1171354401 INV630 57 1169109240 INV631 33 1180944266 INV632 71 1161598987 INV633 27 1180766127 INV634 51 1070432710 INV635 56 1164447597 INV636 64 1179256986 INV637 45 1051339601 INV638 20 1162714028 INV639 10 970886833 INV64 57 1177403601 INV640 51 1166471254 INV641 27 1124653331 INV642 14 1159484511 INV643 22 1182454075 INV644 17 1003622594 INV645 6 1027416730 INV646 21 1161892934 INV647 69 831761194 INV648 4 1089471972 INV649 9 1101980534 INV65 61 1151453162 INV650 44 1175702680 INV651 41 1131505858 INV652 10 1066812585 INV653 4 980796239 INV654 20 1183594436 INV655 43 1163249106 INV656 47 1144061752 INV657 10 1165110718 INV658 62 1179093290 INV659 52 1180864361 INV66 99 1179883867 INV660 47 1159707827 INV661 12 1023645300 INV662 3 1157463834 INV663 3 1060904444 INV664 4 1181112588 INV665 15 1171997463 INV666 28 938338623 INV667 5 1137688336 INV668 16 1154482827 INV669 50 1180339018 INV67 43 1181610918 INV670 31 1179713034 INV671 31 1098347645 INV672 8 1160538827 INV673 18 1021456030 INV674 2 1006091031 INV675 2 951616379 INV676 2 871667885 INV677 2 818376178 INV678 3 1052261518 INV679 3 939543120 INV68 74 1164699481 INV680 32 1090180866 INV681 6 1170627702 INV682 32 1053262233 INV683 8 1121167788 INV684 9 1108544100 INV685 11 1152684900 INV686 14 1154185609 INV687 38 1134271676 INV688 19 1177658696 INV689 44 1177518978 INV69 250378 709301343 INV690 22 1079647998 INV691 11 1179569133 INV692 5 887314561 INV693 1 690419613 INV694 1 688810701 INV695 1 639929110 INV696 1 625027500 INV697 1 623195831 INV698 1 617718696 INV699 2 1167479169 INV7 425 1163622155 INV70 28970 1129807391 INV700 2 1124973432 INV701 2 972905134 INV702 6 1143958739 INV703 41 1179501029 INV704 39 1145476693 INV705 14 1142072413 INV706 21 1176695123 INV707 31 1172264547 INV708 62 1137054351 INV709 27 1175819084 INV71 134 1177390952 INV710 23 891961094 INV711 9 1167542534 INV712 67 1134243551 INV713 26 1029705715 INV714 3 1143035150 INV715 43 1165738581 INV716 12 1137462971 INV717 5 1072259877 INV718 7 1180876279 INV719 35 1175805876 INV72 63 1176539335 INV720 18 1093802415 INV721 22 1176383333 INV722 57 1183010513 INV723 53 1179327736 INV724 21 1167194720 INV725 40 1176398187 INV726 42 1147439138 INV727 27 1168321087 INV728 23 1166281917 INV729 33 1151216138 INV73 76 1165743018 INV730 18 1000323493 INV731 25 1183567352 INV732 37 1092604927 INV733 195 1163550044 INV734 33 950798212 INV735 30 1152607316 INV736 37 1165714265 INV737 33 1068556053 INV738 11 1115976464 INV739 27 1161045343 INV74 166 1179537379 INV740 35 1171844836 INV741 33 1159525911 INV742 41 1180390883 INV743 11 1024131553 INV744 9 1085975686 INV745 42 1147992208 INV746 37 1181637273 INV747 38 1081813347 INV748 3 1174046842 INV749 20 1178261379 INV75 66 1152695960 INV750 46 1178413119 INV751 13 1142733896 INV752 10 1130174875 INV753 22 1175825264 INV754 19 1163517885 INV755 18 1152640158 INV756 15 1147311777 INV757 11 1091619980 INV758 38 1170155090 INV759 29 1173715878 INV76 86 1160209850 INV760 35 835977582 INV761 2 940631047 INV762 2 928744483 INV763 2 883129211 INV764 3 1143834446 INV765 4 1134397883 INV766 250 1171544750 INV767 44 1136955202 INV768 10 1154316587 INV769 49 1174737284 INV77 81 1179556238 INV770 29 1166236126 INV771 12 1175327206 INV772 45 1153063095 INV773 36 1107145470 INV774 51 1145790976 INV775 33 1069665695 INV776 39 1139985500 INV777 32 1175690890 INV778 20 1132543617 INV779 24 1176271695 INV78 73 1174979111 INV780 63 1123179244 INV781 142 1139463992 INV782 36 1181524309 INV783 24 1115387771 INV784 49 1150209817 INV785 20 1083179547 INV786 8 1098795584 INV787 10 1147577596 INV788 12 1181888711 INV789 27 1175290982 INV79 58 1178263797 INV790 40 1060130206 INV791 8 1129793124 INV792 40 1160847583 INV793 31 1180662633 INV794 30 1171761940 INV795 25 1081426888 INV796 18 1003956340 INV797 5 1028031751 INV798 8 1084093438 INV799 9 1085930053 INV8 81 1182347840 INV80 90 1163122154 INV800 12 1156139919 INV801 16 1152066914 INV802 34 1175667989 INV803 70 1176610322 INV804 24 1179259380 INV805 11 1105396847 INV806 12 1115650974 INV807 13 1176755746 INV808 35 1182242624 INV809 13 962698360 INV81 419146 383026257 INV810 4 998118856 INV811 11 1172986735 INV812 34 1119944490 INV813 51 1169563167 INV814 13 1118920573 INV815 72 1179683902 INV816 79 1118509722 INV817 7 1078681531 INV818 11 1179163002 INV819 22 789281094 INV82 456011 336389732 INV820 4 1079695977 INV821 9 1111645608 INV822 16 1182708412 INV823 31 1103328307 INV824 25 853793460 INV825 7 1129785984 INV826 19 1105886509 INV827 9 1143534659 INV828 13 1174582815 INV829 69 1175357321 INV83 461662 340354707 INV830 80 1153031168 INV831 41 1164065325 INV832 61 1162032954 INV833 40 1123882437 INV834 9 1130047032 INV835 11 1116235507 INV836 13 1126566723 INV837 28 1172489440 INV838 51 1136459610 INV839 12 1062372964 INV84 440044 293385431 INV840 10 1112670569 INV841 68 1181896580 INV842 71 1177368065 INV843 65 1111204596 INV844 15 1173116435 INV845 37 1142589085 INV846 12 1124247542 INV847 19 1161505884 INV848 24 1171403553 INV849 41 1165677686 INV85 416311 246708707 INV850 20 1180506747 INV851 986 1170772584 INV852 42 1165980829 INV853 40 1171861906 INV854 36 1077524818 INV855 9 1047907154 INV856 8 1141384454 INV857 15 1168272058 INV858 61 1178023607 INV859 65 1170721200 INV86 410829 264167436 INV860 14 1053590254 INV861 10 1057950276 INV862 8 1127887377 INV863 4 1020160878 INV864 7 1147749005 INV865 33 1176769105 INV866 20 1168205515 INV867 12 1141663061 INV868 39 1171208474 INV869 9 974544864 INV87 446517 344454763 INV870 10 1175733994 INV871 39 1166578258 INV872 29 1161961409 INV873 23 1154939966 INV874 25 1177277453 INV875 51 1133982829 INV876 86 1176021019 INV877 75 1177037179 INV878 32 1151881647 INV879 8 1135911959 INV88 430455 577080708 INV880 8 919810433 INV881 3 1139338401 INV882 3 972340244 INV883 4 1157140290 INV884 5 1126736368 INV885 31 1182264396 INV886 66 1178364544 INV887 35 1034534722 INV888 44 1177143306 INV889 43 1083170751 INV89 322869 856597158 INV890 9 1127837545 INV891 49 1177583056 INV892 70 1183935958 INV893 70 1175817111 INV894 48 1144611323 INV895 20 1130825940 INV896 84 1178249363 INV897 74 1171197019 INV898 50 1179606929 INV899 78 1175655092 INV9 72 1118773557 INV90 264135 867549651 INV900 75 1173593307 INV901 30 1132766399 INV902 13 1149268122 INV903 55 1173118698 INV904 57 1183964102 INV905 72 1163162176 INV906 69 1170172550 INV907 55 1171372002 INV908 69 1174685523 INV909 49 1059075259 INV91 244336 909503841 INV910 11 1138880319 INV911 21 1180633677 INV912 52 1182842349 INV913 20 1136109675 INV914 166 1166973070 INV915 67 1180049046 INV916 60 1152975227 INV917 26 1174031121 INV918 54 1126316641 INV919 38 1179060196 INV92 3686 1154591691 INV920 89 1170538515 INV921 60 1173978256 INV922 48 1160113059 INV923 39 1173248833 INV924 11 1074853584 INV925 63 1183884811 INV926 63 1176071004 INV927 75 1170180101 INV928 69 1173763390 INV929 25 1121271916 INV93 962 1179067574 INV930 10 1095899144 INV931 8 1164382747 INV932 93 1165196265 INV933 78 1168904468 INV934 82 1171992942 INV935 65 1167524297 INV936 73 1179022413 INV937 60 1170979057 INV938 58 1040223970 INV939 17 1182228057 INV94 10611 1079874304 INV940 30 1178396280 INV941 34 1170657200 INV942 68 1179161421 INV943 73 1177604286 INV944 65 1175686161 INV945 22 1160816021 INV946 20 1121686706 INV947 41 1181858455 INV948 82 1177890348 INV949 60 1183453569 INV95 82 1093523026 INV950 46 1123649934 INV951 14 1181653645 INV952 59 1146738923 INV953 30 1156276741 INV954 53 1174206506 INV955 53 1133051755 INV956 36 1168921893 INV957 92 1179030018 INV958 68 1165686090 INV959 53 1164652568 INV96 665 1126514836 INV960 75 1179733947 INV961 75 1182677230 INV962 74 1174310330 INV963 65 1172491681 INV964 54 1168937707 INV965 53 1183899948 INV966 29 1116946954 INV967 14 1182872022 INV968 20 1180560669 INV969 13 1068614973 INV97 62213 1098837354 INV970 12 1135184891 INV971 66 1170036182 INV972 67 1178147787 INV973 54 1176258633 INV974 52 1173175924 INV975 48 1182987332 INV976 37 1176906847 INV977 25 1165229338 INV978 41 1168712785 INV979 64 1173262201 INV98 64 1170346149 INV980 17 1128750053 INV981 6 1129534681 INV982 41 1168552511 INV983 66 1165626690 INV984 78 1178927010 INV985 37 1165600476 INV986 40 1129415356 INV987 27 1170455825 INV988 8 1122013248 INV989 6 1057437514 INV99 86 1180170203 INV990 7 1076295190 INV991 9 1155288781 INV992 32 1177676732 INV993 28 1120530576 INV994 38 1169820714 INV995 52 1163870155 INV996 39 1163923789 INV997 22 1146968860 INV998 23 1001905370 INV999 7 1154394559 MAM1 54649 917178765 MAM10 17 1127029450 MAM100 11 1123128407 MAM101 15 1161638067 MAM102 55 980993111 MAM103 7 1146926981 MAM104 9 1148341500 MAM105 11 1096082864 MAM106 12 1138729465 MAM107 14 1043866406 MAM108 7 1172863037 MAM109 16 1053097667 MAM11 18 1142664549 MAM110 10 1162520257 MAM111 11 952516490 MAM112 6 1122569703 MAM113 17 1165518968 MAM114 8 1131294285 MAM115 14 1129345140 MAM116 12 1069190761 MAM117 7 1179239711 MAM118 22 1112642816 MAM119 11 1173438088 MAM12 15 1132274725 MAM120 20 1174355561 MAM121 10 1151843378 MAM122 18 1161906477 MAM123 10 1166105597 MAM124 16 1017293610 MAM125 4 1044858104 MAM126 6 1118368376 MAM127 9 1059085083 MAM128 8 1135087546 MAM129 8 1045852539 MAM13 9 1181471817 MAM130 7 1058266063 MAM131 9 909509829 MAM132 4 1023412101 MAM133 6 1114170190 MAM134 9 1093712676 MAM135 18 1168423018 MAM136 9 1071699428 MAM137 12 1128966733 MAM138 10 1161373152 MAM139 11 1109349525 MAM14 14 1173406720 MAM140 13 1051114085 MAM141 9 1088893088 MAM142 12 1099118976 MAM143 17 1182972727 MAM144 12 1124668268 MAM145 16 1139361885 MAM146 8 1103046001 MAM147 16 1020440593 MAM148 6 1065416239 MAM149 10 1153279637 MAM15 10 1131536607 MAM150 9 996023330 MAM151 7 1082531652 MAM152 13 1108633531 MAM153 11 1133364406 MAM154 15 1131823350 MAM155 10 1121945730 MAM156 13 1026940761 MAM157 7 1116615210 MAM158 13 1062694187 MAM159 11 1159279927 MAM16 14 1173052009 MAM160 14 1133199111 MAM161 8 1172892011 MAM162 13 1183659191 MAM163 9 1144699482 MAM164 15 1092468729 MAM165 10 1119263878 MAM166 15 1121786028 MAM167 7 1153154205 MAM168 9 1003949427 MAM169 7 1071154379 MAM17 12 1057388218 MAM170 14 1060069106 MAM171 7 1116868036 MAM172 18 1141673221 MAM173 14 1175501398 MAM174 20 1103834537 MAM175 6 1140764022 MAM176 11 1155922031 MAM177 8 1095264193 MAM178 11 1172588480 MAM179 11 1158132797 MAM18 10 1098097203 MAM180 9 1107850457 MAM181 12 1149743882 MAM182 14 1159621796 MAM183 12 1101208670 MAM184 9 1122997471 MAM185 237 1012089215 MAM186 11 1140809596 MAM187 16 1183291622 MAM188 20 1124444480 MAM189 7 1106177041 MAM19 15 1026611779 MAM190 17 1002015229 MAM191 7 1170002033 MAM192 13 1161936973 MAM193 7 1072854491 MAM194 11 1148605221 MAM195 14 1100711659 MAM196 15 1131042125 MAM197 18 1108119784 MAM198 13 1108528549 MAM199 21 1087372648 MAM2 7 1177030125 MAM20 6 1069522997 MAM200 12 1121609399 MAM201 19 1128563115 MAM202 13 1100818648 MAM203 18 1144458293 MAM204 33 1074228493 MAM205 8 1156774478 MAM206 10 1089873653 MAM207 11 1180488051 MAM208 13 1092246428 MAM209 10 1107227900 MAM21 12 1147180873 MAM210 650 1138608111 MAM211 10 1124944525 MAM212 16 1120466794 MAM213 9 1148012777 MAM214 13 1150172582 MAM215 12 1077773393 MAM216 10 1139986258 MAM217 16 1064969919 MAM218 9 1164026957 MAM219 13 1155284771 MAM22 13 1089172779 MAM220 13 1169857650 MAM221 10 1124439334 MAM222 16 1151835508 MAM223 9 1154952001 MAM224 13 1144394793 MAM225 14 1110125076 MAM226 11 1161667474 MAM227 8 1114356368 MAM228 11 1129721373 MAM229 17 1178026814 MAM23 8 1147102555 MAM230 9 1100817071 MAM231 9 1183908033 MAM232 15 1114796622 MAM233 14 1163485023 MAM234 22 1161321398 MAM235 35279 332947185 MAM24 17 1161495983 MAM25 7 1160364752 MAM26 14 1119860958 MAM27 12 1168070061 MAM28 11 1147190445 MAM29 16 1179712380 MAM3 45056 812377816 MAM30 10 1156184385 MAM31 16 1138379370 MAM32 9 1133234150 MAM33 12 1136792441 MAM34 14 1083174451 MAM35 10 1114325055 MAM36 16 1100855100 MAM37 8 1087010659 MAM38 12 1132313879 MAM39 86253 1052142555 MAM4 5 977148124 MAM40 67638 1075400026 MAM41 20 1168721798 MAM42 262111 630368652 MAM43 1 716413629 MAM44 1 662751787 MAM45 2 1076242322 MAM46 6 1060323989 MAM47 7 1157094405 MAM48 374 1047383769 MAM49 11 1148682982 MAM5 13 1070912825 MAM50 270 1107760733 MAM51 16 1096674869 MAM52 11 1153008662 MAM53 15 1183890503 MAM54 3346 1174847022 MAM55 212698 653836160 MAM56 14 1150878060 MAM57 13 1088164282 MAM58 283 1091974375 MAM59 8 1109473464 MAM6 13 1061705218 MAM60 401 1097761183 MAM61 8 1179634014 MAM62 36 1090251500 MAM63 9 1118303675 MAM64 15 1166025468 MAM65 11 1122869337 MAM66 11 1153252717 MAM67 280 1019432764 MAM68 7 1179409361 MAM69 14 1113790013 MAM7 15 1160135387 MAM70 7 1098512340 MAM71 12 1149034595 MAM72 14 1155580838 MAM73 17 1128166897 MAM74 14 1105329474 MAM75 10 1174291860 MAM76 10 1119665667 MAM77 9 1177569791 MAM78 17 1028774100 MAM79 9 1137930415 MAM8 20 1124934750 MAM80 14 1061883364 MAM81 8 1162431176 MAM82 14 1127176217 MAM83 7 1104289556 MAM84 10 1116587684 MAM85 15 1097498025 MAM86 16 1122406742 MAM87 13 1044845556 MAM88 10 1183235581 MAM89 15 1154898355 MAM9 21 1147650305 MAM90 12 1149723292 MAM91 165 1088602904 MAM92 12 1142857057 MAM93 22 1023460094 MAM94 6 1069359459 MAM95 12 1067857639 MAM96 10 1096190530 MAM97 12 1006394206 MAM98 7 1130042281 MAM99 13 1091509542 PAT1 1093014 539655508 PAT10 680819 492649438 PAT11 681021 368775896 PAT12 512775 633418639 PAT13 713924 305204754 PAT14 604760 511811777 PAT15 1067049 29471928 PAT16 1086594 20709984 PAT17 1003475 603540319 PAT18 1082282 408230976 PAT19 1269256 483013637 PAT2 771002 511607107 PAT20 957110 648346460 PAT21 703656 781272147 PAT22 959599 614295681 PAT23 1206549 431768824 PAT24 1098490 363425135 PAT25 880343 445355797 PAT26 1584823 67235174 PAT27 1015462 515183619 PAT28 1071342 563392400 PAT29 885194 639961794 PAT3 745606 413091211 PAT30 763793 636283555 PAT31 627165 425487168 PAT32 500771 555999843 PAT33 730073 274345917 PAT34 281603 357450824 PAT35 590795 303966613 PAT36 962156 378847929 PAT37 547645 777367103 PAT38 967933 455314475 PAT39 1548138 54684419 PAT4 842725 549293249 PAT40 781327 691102013 PAT41 635216 559767307 PAT42 299754 606471722 PAT43 444590 290143618 PAT44 897520 198245077 PAT45 1066862 350040289 PAT46 722917 158094741 PAT47 556107 299506523 PAT48 436729 275762342 PAT49 685018 336510330 PAT5 692798 426112949 PAT50 553002 223306903 PAT51 634414 208851349 PAT52 456483 603752999 PAT53 387515 503480538 PAT54 763530 199284337 PAT55 602981 167531795 PAT56 246323 377411506 PAT57 869588 107519545 PAT58 957852 339345716 PAT59 772793 725163078 PAT6 748842 287605563 PAT60 564810 857906642 PAT61 668136 796635383 PAT62 750706 710490996 PAT63 979924 539152309 PAT64 707448 771967321 PAT65 730603 764763454 PAT66 761514 739187014 PAT67 469712 819779235 PAT68 708653 310855555 PAT69 846990 63836990 PAT7 704494 359976221 PAT70 853138 51597656 PAT71 867485 325401792 PAT72 729534 747659739 PAT73 775392 744047933 PAT74 1132815 480944097 PAT75 715743 258325977 PAT76 589183 403193493 PAT77 599816 456659616 PAT78 484111 421088284 PAT79 677982 310802730 PAT8 715926 518571827 PAT80 750446 231735330 PAT81 682395 286961288 PAT82 746244 245634073 PAT83 685187 656830329 PAT84 1048762 516766210 PAT85 456538 822122255 PAT86 627760 442788720 PAT87 77860 103667012 PAT9 944118 594022814 PHG1 18916 657185701 PHG2 16405 684294043 PHG3 18817 656728359 PLN1 182538 827883424 PLN10 121 1176725979 PLN100 86 1139773419 PLN100 2 1001409659 PLN100 2 893820450 PLN100 2 792424744 PLN100 2 920717366 PLN100 2 896028614 PLN100 2 987715268 PLN100 2 937102711 PLN100 2 1157469576 PLN100 1 645883436 PLN100 1 722286459 PLN101 34 1182869104 PLN101 1 607918071 PLN101 2 1174769074 PLN101 2 1002982585 PLN101 2 889718118 PLN101 2 793131090 PLN101 2 1037045417 PLN101 2 903322146 PLN101 2 979052875 PLN101 2 869125002 PLN101 2 1037353032 PLN102 98 1142999387 PLN102 1 640286297 PLN102 1 723544248 PLN102 1 608881740 PLN102 2 1176695126 PLN102 2 995556922 PLN102 2 891989265 PLN102 2 783809130 PLN102 2 926581393 PLN102 2 859536614 PLN102 2 958111117 PLN103 120 1123411044 PLN103 2 860654870 PLN103 2 1137467819 PLN103 1 636076989 PLN103 1 705781708 PLN103 1 610678771 PLN103 2 1182379956 PLN103 2 994219910 PLN103 2 889349485 PLN103 2 783594804 PLN103 2 1048428776 PLN104 16 1129758581 PLN104 2 902669640 PLN104 2 976270959 PLN104 2 877198120 PLN104 2 1045889334 PLN104 1 631768924 PLN104 1 725180463 PLN104 1 621034056 PLN104 2 1182620279 PLN104 2 1014650959 PLN104 2 925977292 PLN105 16 1139423786 PLN105 2 802504191 PLN105 2 1048138740 PLN105 2 898946577 PLN105 2 994932611 PLN105 2 941716412 PLN105 2 1033870298 PLN105 1 629114855 PLN105 1 718751037 PLN105 1 611494931 PLN105 2 1162943788 PLN106 16 1151133023 PLN106 2 1003084907 PLN106 2 894080254 PLN106 2 790531857 PLN106 2 1002920523 PLN106 2 809306527 PLN106 2 871801254 PLN106 2 851068815 PLN106 2 964454783 PLN106 1 594708330 PLN106 1 690762274 PLN107 16 1144877896 PLN107 1 590814229 PLN107 2 1138983592 PLN107 2 984908801 PLN107 2 876663954 PLN107 2 798117284 PLN107 2 959216543 PLN107 2 829210607 PLN107 2 902495809 PLN107 2 870525246 PLN107 2 993181938 PLN108 16 1134971335 PLN108 1 600661488 PLN108 1 683702423 PLN108 1 598878187 PLN108 2 1150466367 PLN108 2 980607225 PLN108 2 873342373 PLN108 2 802221197 PLN108 2 1019738497 PLN108 2 878056074 PLN108 2 961314824 PLN109 16 1128834202 PLN109 2 835696587 PLN109 2 1044299173 PLN109 1 634903712 PLN109 1 712120691 PLN109 1 607465355 PLN109 1 647692431 PLN109 2 999230512 PLN109 2 913003758 PLN109 2 901295280 PLN109 2 807785814 PLN11 81 1074115299 PLN110 16 1130802376 PLN110 2 1031086399 PLN110 2 906412178 PLN110 2 956502006 PLN110 2 961188440 PLN110 1 584507776 PLN110 1 642262167 PLN110 1 728462677 PLN110 1 618599891 PLN110 1 629235837 PLN110 2 1054411560 PLN111 16 1153968170 PLN111 2 1011739385 PLN111 2 954062059 PLN111 2 787867849 PLN111 2 1028517569 PLN111 2 919877796 PLN111 2 931428971 PLN111 2 890177434 PLN111 1 569032097 PLN111 1 644753636 PLN111 1 731387311 PLN112 54 1182810112 PLN112 1 616277857 PLN112 2 1172520313 PLN112 2 1010984114 PLN112 2 862353942 PLN112 2 804517731 PLN112 2 1062351926 PLN112 2 913914737 PLN112 2 1003018414 PLN112 2 974011118 PLN112 2 1135260387 PLN113 25 630620362 PLN113 1 643979036 PLN113 1 727930754 PLN113 1 617967281 PLN113 1 640169160 PLN113 2 1033044471 PLN113 2 1009143696 PLN113 2 952600981 PLN113 2 801703061 PLN113 2 1016171170 PLN113 2 937815470 PLN114 1 646201372 PLN114 2 935641703 PLN114 2 952747353 PLN114 1 596747793 PLN114 1 641130271 PLN114 1 718411403 PLN114 1 624013310 PLN114 1 629224446 PLN114 2 1037991730 PLN114 2 1008655367 PLN114 2 975281013 PLN115 1 587623253 PLN115 293 1160679016 PLN115 10 1130017029 PLN115 35 1153827226 PLN115 16 1085311577 PLN115 132 1153802929 PLN115 21 1138792300 PLN115 20 1174411096 PLN115 195 720432698 PLN115 1 599230268 PLN115 1 709345803 PLN116 1 663525381 PLN116 1 499575344 PLN116 1 795989443 PLN116 1 809120074 PLN116 1 670531570 PLN116 1 759055895 PLN116 1 872909281 PLN116 1 637083831 PLN116 1 765902670 PLN116 1 688536368 PLN116 1 533804092 PLN117 2 1170194602 PLN117 1 714878730 PLN117 1 728610199 PLN117 1 586077705 PLN117 1 622419581 PLN117 1 733835468 PLN117 1 506756789 PLN117 1 759450946 PLN117 1 768174826 PLN117 3 659068422 PLN117 1 865431811 PLN118 52 1140868282 PLN118 1 841368522 PLN118 1 772393794 PLN118 1 766078222 PLN118 1 735900830 PLN118 1 693266847 PLN118 1 690056233 PLN118 1 654671025 PLN118 1 681539918 PLN118 1 650134427 PLN118 1 643737533 PLN119 53 1137938586 PLN119 2 1092839925 PLN119 2 1066926645 PLN119 2 971611548 PLN119 13 427663120 PLN119 1 1574527093 PLN119 1 1805244829 PLN119 1 1716769615 PLN119 1 1637815978 PLN119 1 1645877737 PLN119 1 1365994436 PLN12 23 1134451674 PLN120 23 1161219862 PLN120 1 1520236431 PLN120 21 825294730 PLN120 1 660114068 PLN120 1 623862790 PLN120 1 606413785 PLN120 2 1155915948 PLN120 2 1148187217 PLN120 1 662966845 PLN120 1 626943711 PLN120 1 613583204 PLN121 49 1182120568 PLN121 2 1152592070 PLN121 2 1147808788 PLN121 1 656479363 PLN121 1 621609376 PLN121 1 611088072 PLN121 2 1140013277 PLN121 2 1154214120 PLN121 1 661498744 PLN121 1 626053568 PLN121 1 608346219 PLN122 43 1182331514 PLN122 2 1151823422 PLN122 2 1162621306 PLN122 1 661546608 PLN122 1 633922074 PLN122 1 612932250 PLN122 2 1146351859 PLN122 2 1158675416 PLN122 1 664715623 PLN122 1 631770265 PLN122 1 613234972 PLN123 43 1175719222 PLN123 1 604325310 PLN123 1 582152544 PLN123 2 1158575799 PLN123 1 661621317 PLN123 1 626868012 PLN123 1 607094319 PLN123 2 1149874108 PLN123 2 1149787837 PLN123 1 656602423 PLN123 1 622110859 PLN124 43 1183406182 PLN124 1 612883152 PLN124 2 1142529769 PLN124 2 1154234909 PLN124 1 656789389 PLN124 1 625372561 PLN124 1 603451504 PLN124 2 1159731212 PLN124 2 1150269419 PLN124 1 657552530 PLN124 1 618447767 PLN125 42 1163229317 PLN125 1 613586716 PLN125 2 1143934454 PLN125 2 1152640102 PLN125 1 676241010 PLN125 1 632313166 PLN125 1 603807353 PLN125 2 1155326502 PLN125 2 1150412865 PLN125 1 662000247 PLN125 1 633487160 PLN126 44 1182265834 PLN126 1 612164168 PLN126 2 1159122729 PLN126 2 1150238410 PLN126 1 660449817 PLN126 1 627269420 PLN126 1 602651360 PLN126 2 1162506895 PLN126 2 1158496591 PLN126 1 664401522 PLN126 1 626503588 PLN127 82 1008208987 PLN127 1 611188438 PLN127 2 1171231026 PLN127 2 1156345588 PLN127 1 657436430 PLN127 1 621715108 PLN127 1 610707416 PLN127 2 1147845639 PLN127 2 1151723189 PLN127 1 660500976 PLN127 1 634743673 PLN128 2 747319580 PLN128 1 616002081 PLN128 2 1150169128 PLN128 2 1153490048 PLN128 1 669356984 PLN128 1 631173187 PLN128 1 607766370 PLN128 2 1145806163 PLN128 2 1143277701 PLN128 1 664077638 PLN128 1 624178744 PLN129 2 884812093 PLN129 1 609451706 PLN129 2 1144639091 PLN129 1 631526965 PLN129 1 660034972 PLN129 1 625104971 PLN129 1 608830648 PLN129 2 1146797356 PLN129 2 1146984767 PLN129 1 526310788 PLN129 1 664689228 PLN13 19 1043680087 PLN130 2 918639035 PLN130 1 632403820 PLN130 1 613638454 PLN130 2 1172960765 PLN130 2 1147017396 PLN130 1 660476038 PLN130 1 624334204 PLN130 1 613769411 PLN130 2 1147499918 PLN130 2 1148490360 PLN130 1 663019822 PLN131 7 1170902936 PLN131 1 626669531 PLN131 1 612901747 PLN131 2 1150057662 PLN131 2 1157797487 PLN131 1 667210568 PLN131 1 635382001 PLN131 1 614569426 PLN131 2 1169192410 PLN131 2 1163716432 PLN131 1 626973123 PLN132 28 1037362098 PLN132 1 611284754 PLN132 2 1150481064 PLN132 1 659290088 PLN132 2 1150737255 PLN132 1 660553991 PLN132 1 632999331 PLN132 1 616334843 PLN132 2 1174596045 PLN132 2 1159220941 PLN132 1 659217363 PLN133 2 746994619 PLN133 1 627225202 PLN133 1 611858135 PLN133 2 1164391514 PLN133 2 1152376894 PLN133 1 660591081 PLN133 1 627080904 PLN133 1 609113147 PLN133 2 1138662036 PLN133 2 1154130688 PLN133 1 659787933 PLN134 2 884447165 PLN134 1 626680366 PLN134 1 612118009 PLN134 2 1146809099 PLN134 2 1153763781 PLN134 1 662624081 PLN134 1 626502968 PLN134 1 614857888 PLN134 2 1161694293 PLN134 2 1153142705 PLN134 1 669220190 PLN135 2 918277773 PLN135 1 629226312 PLN135 1 613110551 PLN135 2 1144904879 PLN135 2 1160236768 PLN135 1 658438119 PLN135 1 628047470 PLN135 1 612916554 PLN135 2 1143852611 PLN135 2 1150763450 PLN135 1 657631428 PLN136 31 1165164536 PLN136 1 629616096 PLN136 1 610488678 PLN136 2 1145704528 PLN136 2 1148031132 PLN136 1 655385637 PLN136 1 626286153 PLN136 1 610690180 PLN136 2 1141737084 PLN136 2 1145450335 PLN136 1 659936173 PLN137 30 1167366437 PLN137 1 627661034 PLN137 1 608478632 PLN137 2 1164887918 PLN137 2 1157801119 PLN137 1 654540277 PLN137 1 624453744 PLN137 1 610565479 PLN137 2 1154225896 PLN137 2 1144646810 PLN137 1 661109612 PLN138 24 1154880996 PLN138 1 624188817 PLN138 1 609603980 PLN138 2 1153106963 PLN138 2 1149274143 PLN138 1 657668641 PLN138 1 627263816 PLN138 1 611107145 PLN138 2 1143888586 PLN138 2 1151475536 PLN138 1 659552134 PLN139 28 1130965431 PLN139 1 627284235 PLN139 1 612025601 PLN139 2 1148289352 PLN139 2 1155467049 PLN139 1 660627594 PLN139 1 636764043 PLN139 1 612684114 PLN139 2 1172404752 PLN139 2 1143811555 PLN139 1 660087335 PLN14 4 927535920 PLN140 42 1175261473 PLN140 1 626870575 PLN140 1 607666773 PLN140 2 1160190638 PLN140 2 1151319163 PLN140 1 663157241 PLN140 1 626857742 PLN140 1 607587567 PLN140 2 1166417974 PLN140 2 1149892400 PLN140 1 660726353 PLN141 14 1122538268 PLN141 1 625613366 PLN141 1 606853752 PLN141 2 1145435293 PLN141 2 1148608716 PLN141 1 659649991 PLN141 1 630477981 PLN141 1 612914000 PLN141 2 1159094545 PLN141 2 1155390937 PLN141 1 657190419 PLN142 23 1160343908 PLN142 1 626766831 PLN142 1 610506001 PLN142 2 1139699259 PLN142 2 1151798322 PLN142 1 659109138 PLN142 1 625619081 PLN142 1 605020174 PLN142 2 1144201423 PLN142 2 1150772597 PLN142 1 660123737 PLN143 73 1145152026 PLN143 1 626033862 PLN143 1 611584699 PLN143 2 1146634294 PLN143 1 629468067 PLN143 2 1181536715 PLN143 1 634780758 PLN143 1 613857241 PLN143 2 1153523653 PLN143 2 1157943603 PLN143 1 655608708 PLN144 31 1180640568 PLN144 1 630476109 PLN144 1 611734907 PLN144 2 1148834704 PLN144 2 1153026048 PLN144 1 660958633 PLN144 1 628850999 PLN144 1 613418293 PLN144 2 1149130062 PLN144 2 1149230152 PLN144 1 662192201 PLN145 30 1133714852 PLN145 1 624651312 PLN145 1 607896916 PLN145 2 1144733231 PLN145 2 1148913967 PLN145 1 659736604 PLN145 1 626336238 PLN145 1 607408596 PLN145 2 1149881386 PLN145 2 1156807113 PLN145 1 662539114 PLN146 21 1132782447 PLN146 1 634696490 PLN146 1 614659814 PLN146 2 1155079160 PLN146 2 1150818685 PLN146 1 657222892 PLN146 1 629605540 PLN146 1 613053250 PLN146 2 1144594366 PLN146 2 1153001227 PLN146 1 663034619 PLN147 30 1179735766 PLN147 1 623546353 PLN147 1 613383894 PLN147 2 1145099380 PLN147 21 1178182689 PLN147 43 1173368751 PLN147 16 1115226327 PLN147 5 955353777 PLN147 3 875632936 PLN147 2 877648901 PLN147 3 1033679662 PLN148 66 1179383148 PLN148 34 1141347588 PLN148 12 848648943 PLN148 1 655484837 PLN148 1 626855960 PLN148 1 604911185 PLN148 2 1146256337 PLN148 2 1152814527 PLN148 1 631897805 PLN148 1 637173558 PLN148 1 641960388 PLN149 25 1105032020 PLN149 2 1176182574 PLN149 2 1155488842 PLN149 1 660305412 PLN149 1 629753639 PLN149 1 609200707 PLN149 2 1175561398 PLN149 2 1154972860 PLN149 1 659208678 PLN149 1 627226266 PLN149 1 603942392 PLN15 5 1105033693 PLN150 23 1119445046 PLN150 2 1145038912 PLN150 2 1141862336 PLN150 1 661554418 PLN150 1 627699516 PLN150 1 609498991 PLN150 2 1148139209 PLN150 51 1161837995 PLN150 39 664623668 PLN150 2 961863683 PLN150 1 639092456 PLN151 25 1177189409 PLN151 2 1152889042 PLN151 1 616552515 PLN151 1 734473537 PLN151 2 1100022842 PLN151 2 990953513 PLN151 2 1156725275 PLN151 2 921884013 PLN151 2 954999066 PLN151 1 602817757 PLN151 2 1122645515 PLN152 32 1174410663 PLN152 35 1172890850 PLN152 34 1181509311 PLN152 57 655627111 PLN152 2 1017161604 PLN152 2 922997503 PLN152 2 911882306 PLN152 2 873698472 PLN152 1 587083850 PLN152 1 642469393 PLN152 1 724144589 PLN153 33 1110245486 PLN153 1 615753165 PLN153 2 1172530680 PLN153 2 1009216913 PLN153 2 899741267 PLN153 2 777436798 PLN153 2 1013184140 PLN153 2 907946349 PLN153 2 1039764305 PLN153 2 945152050 PLN153 2 1063493089 PLN154 177 1035395085 PLN154 1 635500129 PLN154 1 731176523 PLN154 1 625625058 PLN154 1 632452308 PLN154 2 1048634967 PLN154 2 1001384670 PLN154 2 899195064 PLN154 2 736850637 PLN154 2 1027957952 PLN154 2 928054154 PLN155 65 1042475361 PLN155 2 933112604 PLN155 2 954412960 PLN155 1 587761645 PLN155 1 636006129 PLN155 1 729593106 PLN155 1 612159066 PLN155 1 636108089 PLN155 2 1031361761 PLN155 2 1000678327 PLN155 2 936183749 PLN156 91 1108263664 PLN156 34 1160168125 PLN156 44 916068220 PLN156 1 663523538 PLN156 1 635405230 PLN156 1 611936476 PLN156 2 1150154113 PLN156 2 1161072711 PLN156 1 660736956 PLN156 1 627598042 PLN156 1 612187513 PLN157 57 1145389330 PLN157 2 1155070448 PLN157 2 1145745297 PLN157 1 673406957 PLN157 1 630137118 PLN157 1 612939186 PLN157 2 1151335502 PLN157 2 1155631783 PLN157 1 657661460 PLN157 1 626889213 PLN157 1 610003100 PLN158 8 1170661575 PLN158 2 1148528258 PLN158 2 1146029239 PLN158 1 662475302 PLN158 1 630354994 PLN158 1 612387238 PLN158 2 1155754903 PLN158 2 1149070389 PLN158 1 653250953 PLN158 1 631324550 PLN158 1 609093722 PLN159 70 1155947151 PLN159 2 1149523883 PLN159 2 1145083390 PLN159 1 655260812 PLN159 1 634191159 PLN159 1 614681618 PLN159 2 1172767975 PLN159 2 1152836532 PLN159 1 658721539 PLN159 1 626163282 PLN159 1 609194012 PLN16 4 1121010413 PLN160 93 1113175007 PLN160 2 1153379980 PLN160 2 1162676726 PLN160 1 656359106 PLN160 1 622273932 PLN160 1 610730036 PLN160 2 1152019255 PLN160 2 1150333174 PLN160 1 657708949 PLN160 1 625240013 PLN160 1 610861510 PLN161 37 1168123225 PLN161 2 1136292166 PLN161 2 1152354408 PLN161 1 657289215 PLN161 1 624169276 PLN161 1 611474174 PLN161 2 1152158626 PLN161 2 1154678582 PLN161 1 664634244 PLN161 1 643202471 PLN161 1 617103718 PLN162 186 1136615141 PLN162 2 1161114768 PLN162 2 1163751838 PLN162 1 660262686 PLN162 1 634680428 PLN162 1 612896067 PLN162 2 1153985512 PLN162 2 1159127655 PLN162 1 658111403 PLN162 1 631828453 PLN162 1 612358733 PLN163 111 1097272965 PLN163 2 1172628206 PLN163 2 1161043722 PLN163 1 661402595 PLN163 1 635870417 PLN163 1 617906818 PLN163 2 1154505804 PLN163 2 1161723662 PLN163 1 666500271 PLN163 1 632086707 PLN163 1 607961820 PLN164 21 1157585672 PLN164 2 1173780312 PLN164 21 1134943785 PLN164 29 1167338095 PLN164 33 1171528235 PLN164 12 1152489829 PLN164 92 1120024293 PLN164 30 1144069965 PLN164 31 1131160060 PLN164 37 1171331343 PLN164 18 1137163367 PLN165 18 1076556803 PLN165 18 1108681313 PLN165 11 1140492879 PLN165 14 1175056220 PLN165 51 1162077512 PLN165 14 989011425 PLN165 4 968685916 PLN165 4 989422041 PLN165 4 1035905487 PLN165 4 964344820 PLN165 4 1168659054 PLN166 16 1094460380 PLN166 5 1115864637 PLN166 18 1160077621 PLN166 33 1000994116 PLN166 1 2143528264 PLN166 1 2138631366 PLN166 1 2132989935 PLN166 1 2142145023 PLN166 1 2142779784 PLN166 1 124381055 PLN166 1 2112395848 PLN167 113 1139657744 PLN167 1 2144481838 PLN167 1 2133121580 PLN167 1 2141806609 PLN167 1 1870266305 PLN167 1 2134931027 PLN167 1 2108664250 PLN167 1 2146278775 PLN167 1 2117022170 PLN167 1 1576301307 PLN167 1 2067099338 PLN168 16 1006569123 PLN168 1 2134690998 PLN168 1 2136662657 PLN168 1 2140543523 PLN168 1 1531582847 PLN168 1 2146571508 PLN168 1 2138192289 PLN168 1 2101175359 PLN168 1 2146227213 PLN168 1 621086779 PLN168 1 2138605540 PLN169 3 968319031 PLN169 1 2083688238 PLN169 1 2144314009 PLN169 1 2139184679 PLN169 1 172723629 PLN169 1 2132146989 PLN169 1 2133919239 PLN169 1 2133305249 PLN169 1 2100933269 PLN169 1 143347570 PLN169 1 2134142781 PLN17 5 1117296533 PLN170 4 1129581641 PLN170 1 2145201137 PLN170 1 2137733646 PLN170 1 1914313492 PLN170 1 2145479601 PLN170 1 2114166385 PLN170 1 2146417222 PLN170 1 1555468501 PLN170 1 2141253099 PLN170 1 2119186544 PLN170 1 2142175433 PLN171 26 1170044536 PLN171 1 1498831827 PLN171 9 1052661862 PLN171 13 1137925323 PLN171 34 858656987 PLN171 2 1034251136 PLN171 2 1041322427 PLN171 2 959575375 PLN171 2 1005137949 PLN171 2 1136683915 PLN171 2 1019386330 PLN172 30 1177506240 PLN172 3 1015418383 PLN172 2 1022027198 PLN172 2 1025363455 PLN172 2 931056427 PLN172 2 969293345 PLN172 2 1064158730 PLN172 2 968690797 PLN172 3 980008249 PLN172 2 1043031688 PLN172 2 1031876872 PLN173 44 1155675588 PLN173 2 943080858 PLN173 2 1000998827 PLN173 2 1157028134 PLN173 2 1004786053 PLN173 3 985677594 PLN173 2 1014843260 PLN173 2 1068644986 PLN173 2 948335936 PLN173 2 879747037 PLN173 2 1127570290 PLN174 23 1155141836 PLN174 2 990438732 PLN174 3 875786730 PLN174 2 991559490 PLN174 2 942009307 PLN174 2 906129229 PLN174 2 936264359 PLN174 2 928886758 PLN174 2 935093463 PLN174 2 930365420 PLN174 2 990803747 PLN175 25 1117696136 PLN175 2 885021138 PLN175 2 908456347 PLN175 2 930959077 PLN175 2 1041934893 PLN175 2 942999660 PLN175 3 908571112 PLN175 2 994915609 PLN175 2 1008745383 PLN175 2 850230395 PLN175 2 915695621 PLN176 46 1154003332 PLN176 2 1025227490 PLN176 2 862764790 PLN176 2 884517818 PLN176 2 958486939 PLN176 2 882430803 PLN176 2 805094337 PLN176 2 912116412 PLN176 2 1080442405 PLN176 2 903251998 PLN176 3 846587112 PLN177 34 1147702668 PLN177 2 997148082 PLN177 2 1024702898 PLN177 3 1046276430 PLN177 2 960152348 PLN177 2 997566044 PLN177 2 926826996 PLN177 2 970728340 PLN177 2 1076556621 PLN177 2 961846356 PLN177 3 1105984004 PLN178 35 1177986533 PLN178 2 1091311779 PLN178 2 928973494 PLN178 4 966977223 PLN178 2 1034513146 PLN178 2 973973117 PLN178 2 836784321 PLN178 2 990350501 PLN178 2 1034765442 PLN178 2 918838269 PLN178 2 998373654 PLN179 35 1177744170 PLN179 2 1023553300 PLN179 2 914623388 PLN179 2 836746646 PLN179 2 993956991 PLN179 2 952571408 PLN179 2 873792954 PLN179 3 942162386 PLN179 2 990124494 PLN179 2 909364021 PLN179 2 882617017 PLN18 4 1087849538 PLN180 34 1167895274 PLN180 2 897026796 PLN180 2 1002960583 PLN180 2 873235512 PLN180 2 976812402 PLN180 2 1096125550 PLN180 2 964192102 PLN180 2 869744809 PLN180 2 940385236 PLN180 2 956987604 PLN180 2 893651928 PLN181 34 1162630589 PLN181 11 1138345400 PLN181 17 1160613983 PLN181 17 1152282495 PLN181 17 1161769737 PLN181 17 1137473602 PLN181 16 1149378136 PLN181 17 1140788494 PLN181 17 1173897061 PLN181 17 1169465378 PLN181 9 1142566106 PLN182 34 1158868998 PLN182 1 827770304 PLN182 1 819590567 PLN182 1 657919172 PLN182 1 735222392 PLN182 1 640551262 PLN182 2 850883630 PLN182 1 641523445 PLN182 1 830702509 PLN182 1 817725293 PLN182 1 657518596 PLN183 35 1179550908 PLN183 1 728079018 PLN183 1 637620844 PLN183 2 841520699 PLN183 2 787615973 PLN183 2 1005487930 PLN183 2 870370402 PLN183 2 954925343 PLN183 2 877145967 PLN183 2 915888348 PLN183 2 951785915 PLN184 33 879141121 PLN184 2 976596859 PLN184 2 981034558 PLN184 2 853229614 PLN184 2 968208187 PLN184 2 1065368112 PLN184 2 928206292 PLN184 3 960272742 PLN184 2 1022027198 PLN184 2 1025363455 PLN184 2 931056427 PLN185 1 756690666 PLN185 2 969293345 PLN185 2 1064158730 PLN185 2 968690797 PLN185 3 980008249 PLN185 2 991559490 PLN185 2 942009307 PLN185 2 906129229 PLN185 2 936264359 PLN185 2 928886758 PLN185 2 935093463 PLN186 1 660154351 PLN186 2 930365420 PLN186 2 990803747 PLN186 2 885021138 PLN186 2 908456347 PLN186 2 930959077 PLN186 2 1041934893 PLN186 2 942999660 PLN186 3 908571112 PLN186 2 934307380 PLN186 2 919820886 PLN187 1 785289892 PLN187 2 904199719 PLN187 2 879641827 PLN187 2 1019726094 PLN187 2 948044567 PLN187 2 935988512 PLN187 2 1001554393 PLN187 2 1004892626 PLN187 2 870794531 PLN187 2 886494923 PLN187 2 1089597455 PLN188 1 752191036 PLN188 2 891403268 PLN188 3 916201336 PLN188 2 994915609 PLN188 2 1008745383 PLN188 2 850230395 PLN188 2 915695621 PLN188 2 1025227490 PLN188 2 862764790 PLN188 2 884517818 PLN188 2 958486939 PLN189 2 1138634422 PLN189 2 882430803 PLN189 2 805094337 PLN189 2 912116412 PLN189 2 1080442405 PLN189 2 903251998 PLN189 3 846587112 PLN189 2 1034251136 PLN189 2 1041322427 PLN189 2 959575375 PLN189 2 1005137949 PLN19 5 1095872506 PLN190 1 581969875 PLN190 2 1136683915 PLN190 2 1019386330 PLN190 3 1015418383 PLN190 2 997148082 PLN190 2 1024702898 PLN190 3 1046276430 PLN190 2 960152348 PLN190 2 997566044 PLN190 2 926826996 PLN190 2 970728340 PLN191 1 742820188 PLN191 2 1076556621 PLN191 2 961846356 PLN191 3 1105984004 PLN191 2 1091311779 PLN191 2 928973494 PLN191 4 994697394 PLN191 2 1128818178 PLN191 2 1018548947 PLN191 2 883277256 PLN191 2 1015247550 PLN192 1 722258891 PLN192 2 1033440010 PLN192 2 938819340 PLN192 3 859495519 PLN192 2 1034513146 PLN192 2 973973117 PLN192 2 836784321 PLN192 2 990350501 PLN192 2 1034765442 PLN192 2 973886503 PLN192 2 992822994 PLN193 1 529961705 PLN193 2 897431557 PLN193 2 808457311 PLN193 2 953662853 PLN193 2 1058778957 PLN193 2 930200695 PLN193 3 895052557 PLN193 2 1043031688 PLN193 2 1031876872 PLN193 2 943080858 PLN193 2 1000998827 PLN194 1 696896727 PLN194 2 1157028134 PLN194 2 1004786053 PLN194 3 985677594 PLN194 2 787615973 PLN194 2 1005487930 PLN194 2 870370402 PLN194 2 954925343 PLN194 2 877145967 PLN194 2 915888348 PLN194 2 951785915 PLN195 1 768317091 PLN195 2 976596859 PLN195 2 981034558 PLN195 2 853229614 PLN195 2 968208187 PLN195 2 1065368112 PLN195 2 928206292 PLN195 3 960272742 PLN195 4 1031468481 PLN195 29 1161715798 PLN195 18 1164014015 PLN196 1 635914663 PLN196 86 1098733546 PLN196 12 1140796870 PLN196 53 1160691643 PLN196 29 1105078032 PLN196 50 1145575965 PLN196 43 1177757480 PLN196 43 1150824379 PLN196 34 1155874556 PLN196 50 1155922795 PLN196 47 1132536680 PLN197 1 873778448 PLN197 23 1141693484 PLN197 26 1169836001 PLN197 5 177893042 PLN197 1 1999785258 PLN197 1 1545728702 PLN197 1 1499997841 PLN197 1 1493209057 PLN197 1 1187610474 PLN197 1 943684407 PLN197 8 1161825966 PLN198 1 759363255 PLN198 39 1170204862 PLN198 39 1150468932 PLN198 50 1175229069 PLN198 53 1181331990 PLN198 11 787764687 PLN198 1 656850665 PLN198 1 633960920 PLN198 1 609171657 PLN198 2 1143703028 PLN198 2 979242293 PLN199 1 661150927 PLN199 3 990086045 PLN199 4 1070469512 PLN199 30 961812843 PLN199 2 1109448078 PLN199 1 767071137 PLN199 1 671256291 PLN199 1 670741101 PLN199 1 671191297 PLN199 1 771176557 PLN199 1 643128204 PLN2 215137 732114003 PLN20 4 1116943762 PLN200 1 822617018 PLN200 1 694350238 PLN200 1 641290954 PLN200 2 1174904300 PLN200 1 745638687 PLN200 8 1174732410 PLN200 35 1180289630 PLN200 18 1181205473 PLN200 41 1176106470 PLN200 8 972308232 PLN200 5 998918288 PLN201 1 788135348 PLN201 4 1175221657 PLN201 44 1182640697 PLN201 57 1044582350 PLN201 4 954531898 PLN201 5 1025819629 PLN201 6 984147449 PLN201 5 1137917005 PLN201 5 1007898041 PLN201 6 1070397818 PLN201 5 1111212694 PLN202 1 505466611 PLN202 6 1089162517 PLN202 3 421610440 PLN202 1 956684326 PLN202 1 561974515 PLN202 1 718270646 PLN202 1 682093502 PLN202 1 700447244 PLN202 1 683485999 PLN202 1 723946829 PLN202 1 751391258 PLN203 1 723777933 PLN203 1 651249186 PLN203 2 1175723351 PLN203 2 1136845382 PLN203 128 1170581065 PLN203 54 1049025390 PLN203 68 1088778107 PLN203 73 1119209590 PLN203 22 1127767597 PLN203 46 1093558514 PLN203 68 1114528363 PLN204 5 1107711193 PLN204 41 1064490534 PLN204 10 1140443142 PLN204 29 1112900486 PLN204 70 1142119072 PLN204 99 1179912936 PLN204 96 1181404594 PLN204 67 1084884007 PLN204 2 933307241 PLN204 7 1182242757 PLN204 22 1177390369 PLN205 9 1071213085 PLN205 8 1153933128 PLN205 37 1144473388 PLN205 49 1180784520 PLN205 55 1171927849 PLN205 47 1114711079 PLN205 13 1109766498 PLN205 8 1107099447 PLN205 16 1149081006 PLN205 29 1127504010 PLN205 13 1018612861 PLN206 7 1044550543 PLN206 16 1052342486 PLN206 5 693259785 PLN206 2 1045973173 PLN206 2 1158403266 PLN206 80 1164277484 PLN206 199 1115126474 PLN206 18 1171120860 PLN206 21 1146591206 PLN206 31 1102785788 PLN206 8 1076126098 PLN207 10 1138720651 PLN207 8 864666226 PLN207 2 990024350 PLN207 2 888868060 PLN207 2 933784370 PLN207 2 956308001 PLN207 1 589118817 PLN207 1 638425132 PLN207 1 716105986 PLN207 1 613160974 PLN207 2 1177939381 PLN208 7 1023679923 PLN208 2 1016319037 PLN208 2 936303591 PLN208 2 797242864 PLN208 2 935177588 PLN208 4 1156373581 PLN208 61 1164234229 PLN208 40 1165822149 PLN208 23 1159130017 PLN208 546 872951872 PLN208 4 1128758998 PLN209 8 1058501289 PLN209 6 1144601540 PLN209 3 940719410 PLN209 5 1181840911 PLN209 4 1038695499 PLN209 4 1011553213 PLN209 111 1166142505 PLN209 24 1172060583 PLN209 51 1162442050 PLN209 10 1136931185 PLN209 1 1022901297 PLN21 5 1159914385 PLN210 9 1088046914 PLN210 1 981102465 PLN210 1 976125608 PLN210 1 917323440 PLN210 1 850457102 PLN210 1 839193984 PLN210 1 817723161 PLN210 1 817139115 PLN210 1 814406492 PLN210 1 772677518 PLN210 1 772908146 PLN211 8 1113257928 PLN211 1 765793897 PLN211 1 761983751 PLN211 1 764473882 PLN211 4 1011158055 PLN211 4 1008776197 PLN211 6 815519305 PLN211 2 991469964 PLN211 2 816205905 PLN211 3 1056510218 PLN211 3 989952844 PLN212 9 1067049681 PLN212 3 956055548 PLN212 3 919956468 PLN212 7 1163446212 PLN212 28 1167164746 PLN212 16 1110397238 PLN212 8 590897284 PLN212 1 2000000000 PLN212 1 1520337347 PLN212 1 1784076768 PLN212 1 1723414376 PLN213 8 1154254085 PLN213 1 1713176330 PLN213 1 1422372021 PLN213 1 1587923182 PLN213 48 1182319472 PLN213 64 1176260680 PLN213 77 1166655288 PLN213 75 1046024883 PLN213 6 1144285054 PLN213 5 693883568 PLN213 2 1069887694 PLN214 419 1131241827 PLN214 2 1168781261 PLN214 16 1182073380 PLN214 45 1176527092 PLN214 34 1121126959 PLN214 9 1099497021 PLN214 23 1182637469 PLN214 14 985562895 PLN214 4 1148967398 PLN214 7 1119025184 PLN214 5 1091663592 PLN215 40 1166956996 PLN215 6 1099009318 PLN215 27 1135567827 PLN215 13 1133007134 PLN215 15 1135637088 PLN215 41 1163273408 PLN215 22 1080875863 PLN215 95 1103098914 PLN215 1 949323565 PLN215 1 915317115 PLN215 1 901665926 PLN216 62 1138371687 PLN216 1 822089110 PLN216 1 755633405 PLN216 1 854068172 PLN216 2 1141141404 PLN216 2 1041566903 PLN216 2 1001403931 PLN216 2 875973322 PLN216 43 1173385605 PLN216 30 1092520979 PLN216 19 1076669045 PLN217 12 1174169619 PLN217 25 1151243202 PLN217 41 1092457164 PLN217 8 1107304518 PLN217 14 1177666894 PLN217 76 1124581439 PLN217 5 1103363314 PLN217 8 1175959732 PLN217 20 1168219198 PLN217 141 1182723327 PLN217 64 1153359822 PLN218 24 1143247313 PLN218 11 801094462 PLN218 2 840426663 PLN218 3 1133062094 PLN218 49 967271682 PLN218 2 1130771350 PLN218 2 1164863489 PLN218 2 1091053465 PLN218 2 1110446937 PLN218 1 650429017 PLN218 1 615497416 PLN219 15 1121663306 PLN219 1 605521199 PLN219 2 1151975812 PLN219 2 1040516887 PLN219 1 638826493 PLN219 1 605724068 PLN219 2 1161881882 PLN219 2 1174936293 PLN219 2 1161162149 PLN219 1 618366599 PLN219 1 606666664 PLN22 4 1050249720 PLN220 26 1164059106 PLN220 2 1134915552 PLN220 2 1149087886 PLN220 1 652904783 PLN220 1 620394872 PLN220 1 604515745 PLN220 2 1143962729 PLN220 2 1109768142 PLN220 1 623097078 PLN220 2 1164411152 PLN220 2 1089609646 PLN221 67 1087126918 PLN221 2 1104012305 PLN221 1 653771317 PLN221 1 619592024 PLN221 1 602189318 PLN221 2 1138238587 PLN221 2 1141977764 PLN221 1 662784976 PLN221 1 616351571 PLN221 1 604894944 PLN221 2 1131415633 PLN222 8 1173304541 PLN222 2 1143337624 PLN222 1 655822004 PLN222 1 616990145 PLN222 1 608259649 PLN222 2 1145732503 PLN222 48 1158890732 PLN222 21 1122885516 PLN222 42 954794573 PLN222 4 1030742943 PLN222 6 1183833334 PLN223 9 1158679098 PLN223 96 1165049834 PLN223 1 1034507165 PLN223 1 739697766 PLN223 1 726504577 PLN223 1 697169871 PLN223 1 657249472 PLN223 11 1183269103 PLN223 59 1158848735 PLN223 2 740850932 PLN223 1 613116700 PLN224 198 1144797307 PLN224 2 1110847379 PLN224 1 588160925 PLN224 2 1151556468 PLN224 2 1144988165 PLN224 2 920960533 PLN224 2 964492557 PLN224 2 1026741635 PLN224 2 924313884 PLN224 2 1063012415 PLN224 2 1039365721 PLN225 28 1177758498 PLN225 2 984082969 PLN225 2 1129535037 PLN225 1 606904469 PLN225 1 704570097 PLN225 2 1075296834 PLN225 2 959428510 PLN225 2 1120194583 PLN225 2 907700912 PLN225 2 932374047 PLN225 1 584039244 PLN226 71 1168303214 PLN226 2 1095368857 PLN226 2 1067733679 PLN226 2 1002164729 PLN226 2 1135772918 PLN226 1 615082505 PLN226 1 702454015 PLN226 2 1087084091 PLN226 2 967060173 PLN226 2 1149437878 PLN226 2 922328153 PLN227 56 1180193549 PLN227 2 945865135 PLN227 1 595733490 PLN227 2 1109767937 PLN227 2 861277826 PLN227 2 1005003303 PLN227 2 1145902141 PLN227 1 605355565 PLN227 1 704323042 PLN227 2 1084228640 PLN227 2 960605747 PLN228 44 1166490086 PLN228 2 1135996330 PLN228 2 917706652 PLN228 2 937906817 PLN228 1 590402045 PLN228 2 1097711705 PLN228 2 1078735886 PLN228 2 1029184626 PLN228 1 647763942 PLN228 2 1152087092 PLN228 1 728320446 PLN229 46 1182192162 PLN229 2 1086474352 PLN229 2 990486535 PLN229 1 580285563 PLN229 2 1032931982 PLN229 2 1103429271 PLN229 2 978248508 PLN229 2 1139236022 PLN229 2 1065837260 PLN229 2 1031299716 PLN229 2 1133272237 PLN23 4 930101566 PLN230 46 1171125502 PLN230 1 630752191 PLN230 1 715059151 PLN230 2 1114037314 PLN230 2 989498261 PLN230 1 582262590 PLN230 2 1043392634 PLN230 2 1117131234 PLN230 2 991631299 PLN230 2 1137043038 PLN230 2 1043686811 PLN231 45 1172481102 PLN231 2 981316446 PLN231 2 1138137611 PLN231 1 612059421 PLN231 1 718679113 PLN231 2 1068000765 PLN231 2 973516933 PLN231 2 1161127165 PLN231 2 917801954 PLN231 2 953364613 PLN231 1 593213508 PLN232 45 1151748878 PLN232 27 1137938961 PLN232 25 1150371405 PLN232 22 1177815125 PLN232 62 1165680709 PLN232 11 768041265 PLN232 1 685330109 PLN232 1 696943691 PLN232 1 629773018 PLN232 1 636614816 PLN232 1 579256678 PLN233 46 1183309914 PLN233 27 1145464043 PLN233 3 938113679 PLN233 36 1177868785 PLN233 58 1179369301 PLN233 59 1175284921 PLN233 6 750509095 PLN233 1 697452890 PLN233 1 716474979 PLN233 1 639720019 PLN233 1 636017747 PLN234 45 1161294381 PLN234 1 586421619 PLN234 24 1173039665 PLN234 44 1184118523 PLN234 47 1166901193 PLN234 45 1174667444 PLN234 45 1178395115 PLN234 34 1155109077 PLN234 15 1149879199 PLN234 155 1151814264 PLN234 24 1141119428 PLN235 105 1151050937 PLN235 10 1153314664 PLN235 21 1169844120 PLN235 56 1152974604 PLN235 20 1129272135 PLN235 2 1115555839 PLN235 2 1002974161 PLN235 2 901479101 PLN235 4 732491706 PLN235 1 1127959451 PLN235 1 1087409829 PLN236 34 1168230474 PLN236 1 1046485798 PLN236 1 1019676980 PLN236 1 967807955 PLN236 1 838786986 PLN236 1 700411051 PLN236 1 694962670 PLN236 39 1151215141 PLN236 10 970223738 PLN236 21 1179220770 PLN236 43 1182912800 PLN237 110 1132594037 PLN237 43 1173064982 PLN237 34 1130980249 PLN237 27 1153123167 PLN237 27 1139309430 PLN237 17 1130303106 PLN237 7 805123679 PLN237 1 731695907 PLN237 1 498928130 PLN237 1 795014878 PLN237 1 801925238 PLN238 9708 1129648855 PLN238 1 670943760 PLN238 1 758945776 PLN238 1 869860623 PLN238 1 637624025 PLN238 1 761967929 PLN238 1 691761276 PLN238 1 533851895 PLN238 1 717241891 PLN238 1 738100095 PLN238 1 582137707 PLN239 419916 497476319 PLN239 1 622921430 PLN239 1 746012979 PLN239 1 505005710 PLN239 1 754782214 PLN239 1 767097325 PLN239 26 1180657162 PLN239 14 1135714116 PLN239 13 1142561392 PLN239 9 846608479 PLN239 3 1099362470 PLN24 4 938997910 PLN240 432315 473141449 PLN240 3 962277806 PLN240 27 1181954211 PLN240 49 1175902110 PLN240 16 1114752513 PLN240 10 1089252646 PLN240 14 1041945905 PLN240 3 996194210 PLN240 4 1162029625 PLN240 5 1135478320 PLN240 8 991361234 PLN241 270762 674246446 PLN241 3 1009806456 PLN241 4 1180940189 PLN241 5 1149349845 PLN241 8 1145450003 PLN241 26 1080482572 PLN241 42 1162023041 PLN241 68 1134148184 PLN241 14 1172237460 PLN241 39 1116825586 PLN241 85 1135213375 PLN242 40348 989233219 PLN242 17 1172907744 PLN242 8 800965308 PLN242 1 656321874 PLN242 1 651505715 PLN242 1 644174002 PLN242 2 1127667560 PLN242 4 1008863458 PLN242 1 667753205 PLN242 1 647043717 PLN242 1 631554701 PLN243 16 1131660464 PLN243 2 1110586516 PLN243 4 1001638190 PLN243 2 956645826 PLN243 2 913338306 PLN243 2 818871538 PLN243 3 1123365863 PLN243 55 1175905135 PLN243 6 1105645123 PLN243 8 1106281670 PLN243 11 1161799587 PLN244 513 1075548256 PLN244 14 964438735 PLN244 2 858791006 PLN244 2 827008786 PLN244 3 1074684201 PLN244 39 1178827213 PLN244 20 699529731 PLN244 2 1061138898 PLN244 2 940965553 PLN244 2 887099997 PLN244 6 1096684262 PLN245 8 884564594 PLN245 4 1027996786 PLN245 9 1181145447 PLN245 25 1148907437 PLN245 26 1154104031 PLN245 31 1103110592 PLN245 21 1132854120 PLN245 32 1145336635 PLN245 17 1137937859 PLN245 14 1103576729 PLN245 11 1127684862 PLN246 1 612216829 PLN246 12 1139337127 PLN246 14 1130528758 PLN246 10 1172452672 PLN246 13 1094338854 PLN246 11 1100898515 PLN246 14 1178658871 PLN246 14 1162996306 PLN246 42 1176216584 PLN246 37 1158396193 PLN246 19 1163045581 PLN247 2 1145038356 PLN247 15 1097606314 PLN247 12 1126079850 PLN247 49 1179252764 PLN247 54 1180495350 PLN247 21 1158370784 PLN247 15 901303517 PLN247 4 1056606846 PLN247 4 970045424 PLN247 14 1175815314 PLN247 30 1135519540 PLN248 2 1052833268 PLN248 23 1140759269 PLN248 15 1136230782 PLN248 7 874429687 PLN248 1 630581173 PLN248 1 621322618 PLN248 2 1172198289 PLN248 4 1074886465 PLN248 1 622680414 PLN248 1 620440803 PLN248 2 1176901011 PLN249 869 1141292333 PLN249 2 1119015151 PLN249 2 1124875221 PLN249 2 1080278328 PLN249 2 1030001839 PLN249 2 872835706 PLN249 11 1053089336 PLN249 5 1041729698 PLN249 13 1141735497 PLN249 14 1097636806 PLN249 4 983153695 PLN25 4 1090601783 PLN250 456631 457641463 PLN250 17 1145078255 PLN250 78 1165277206 PLN250 25 1133914880 PLN250 12 1047153246 PLN250 9 1091564069 PLN250 12 1181084579 PLN250 7 1021604808 PLN250 5 1160848550 PLN250 6 1096603711 PLN250 48 1142628787 PLN251 465742 397156379 PLN251 11 966321908 PLN251 5 1113602892 PLN251 18 1152924908 PLN251 54 1142332585 PLN251 17 1015334614 PLN251 7 1119240361 PLN251 10 1124249086 PLN251 18 1061897083 PLN251 2 834923568 PLN251 3 1154803579 PLN252 445912 415252298 PLN252 10 1132248132 PLN252 10 1157631108 PLN252 12 1151523600 PLN252 115 1173341632 PLN252 465 1119780990 PLN252 27 1116817583 PLN252 18 926024497 PLN252 5 1048475623 PLN252 8 1172751465 PLN252 6 989966364 PLN253 407865 445767356 PLN253 6 1114152599 PLN253 18 1177330767 PLN253 25 1154406234 PLN253 20 1158069461 PLN253 21 1140985184 PLN253 22 1163455393 PLN253 32 1151364786 PLN253 12 989635656 PLN253 4 1006862307 PLN253 5 949196134 PLN254 383739 476577993 PLN254 4 993580938 PLN254 8 1135303813 PLN254 10 1135985233 PLN254 13 1075212552 PLN254 11 1103402721 PLN254 14 1182348950 PLN254 81 1183551308 PLN254 38 1178395676 PLN254 85 1161517144 PLN254 41 647535901 PLN255 339336 529701592 PLN255 1 594710261 PLN255 1 697014171 PLN255 1 502462700 PLN255 1 806336100 PLN255 1 811117298 PLN255 1 670536327 PLN255 1 758903171 PLN255 1 849591089 PLN255 1 631961089 PLN255 1 766934839 PLN256 277646 610408196 PLN256 1 691366293 PLN256 1 524389427 PLN256 1 723986579 PLN256 1 741326512 PLN256 1 577757604 PLN256 1 624914147 PLN256 1 728224511 PLN256 1 501068942 PLN256 1 744560595 PLN256 1 740601171 PLN257 52874 1006399655 PLN257 25 1176967435 PLN257 48 1181593803 PLN257 34 1169619694 PLN257 29 1166942441 PLN257 26 1131925608 PLN257 40 1181283842 PLN257 46 1137790003 PLN257 17 1177050011 PLN257 51 920559018 PLN257 1 591862964 PLN258 1965 1094379448 PLN258 1 671280887 PLN258 1 797885371 PLN258 1 810727183 PLN258 1 757079690 PLN258 1 838911320 PLN258 1 760432648 PLN258 1 694322583 PLN258 1 713809180 PLN258 1 739562375 PLN258 1 618044106 PLN259 4309 684572801 PLN259 1 725502821 PLN259 1 743832821 PLN259 37 1181634349 PLN259 102 1181542175 PLN259 48 1152811513 PLN259 26 1158979747 PLN259 14 1035010580 PLN259 23 1165328158 PLN259 13 954363693 PLN259 3 1053546770 PLN26 5 1111969474 PLN260 1 522466905 PLN260 35 885537419 PLN260 4 1067370481 PLN260 6 1117127270 PLN260 4 1092435154 PLN260 6 1127618275 PLN260 4 1073030036 PLN260 6 1113196064 PLN260 4 1090650523 PLN260 6 1136102235 PLN260 4 1041876829 PLN261 1 675310294 PLN261 6 1043659142 PLN261 4 1066154679 PLN261 6 1103201064 PLN261 4 1083220841 PLN261 214 1159336465 PLN261 47 1163517542 PLN261 40 1167357938 PLN261 37 1169719235 PLN261 37 1174367452 PLN261 35 1180681429 PLN262 1 628753756 PLN262 35 1164167480 PLN262 26 1106163656 PLN262 58 1174770723 PLN262 59 1170087745 PLN262 49 1168825712 PLN262 43 1026794045 PLN262 6 1113995029 PLN262 17 1139152472 PLN262 34 1170769744 PLN262 32 1176233295 PLN263 1 624247919 PLN263 27 1073896212 PLN263 20 1103986694 PLN263 14 1060079705 PLN263 13 1057839276 PLN263 5 964213101 PLN263 8 1058854893 PLN263 12 1085293952 PLN263 5 1032446614 PLN263 9 1060901548 PLN263 59 1100332300 PLN264 2 1172266179 PLN264 40 1069431960 PLN264 36 1090922833 PLN264 10 950757506 PLN264 13 995479736 PLN264 14 1024081745 PLN264 18 1067156824 PLN264 22 1122679699 PLN264 27 1165173167 PLN264 46 1183000060 PLN264 14 951625049 PLN265 8558 784305539 PLN265 3 1007783466 PLN265 4 1067366658 PLN265 61 1122944689 PLN265 28 1149195933 PLN265 24 1162983413 PLN265 19 1159516002 PLN265 22 1054227318 PLN265 7 1072184824 PLN265 40 1183524552 PLN265 26 1168047558 PLN266 1 727344967 PLN266 28 1176648412 PLN266 32 1178593993 PLN266 33 1124465200 PLN266 12 1152204612 PLN266 4 678949347 PLN266 1 657756917 PLN266 1 627222211 PLN266 1 607000545 PLN266 2 1139805473 PLN266 9 1122252425 PLN267 1 946003158 PLN267 30 1114385234 PLN267 46 1167997568 PLN267 47 1177658539 PLN267 32 1064160331 PLN267 30 943996975 PLN267 7 1091071095 PLN267 2 1139026097 PLN267 2 1017655985 PLN267 2 947053856 PLN267 2 848130640 PLN268 1 965754312 PLN268 3 1173504592 PLN268 24 1008229949 PLN268 1 775559507 PLN268 1 1011422590 PLN268 1 1128390902 PLN268 1 973439859 PLN268 1 924458964 PLN268 1 943691929 PLN268 3 1130053098 PLN268 17 1126632438 PLN269 1 906459801 PLN269 21 957413489 PLN269 3 987619947 PLN269 5 1101444971 PLN269 29 1106288228 PLN269 14 1177657303 PLN269 27 1162388876 PLN269 55 1180609710 PLN269 135 1167966522 PLN269 37 1174758277 PLN269 33 1040570226 PLN27 3837 1121073683 PLN270 1 876148008 PLN270 6 1089739161 PLN270 7 1117322923 PLN270 8 1107980742 PLN270 6 1132323584 PLN270 7 1122067498 PLN270 60 1162672910 PLN270 64 1147094858 PLN270 12 1117992951 PLN270 10 1175239723 PLN270 11 1167601666 PLN271 1 885153844 PLN271 9 1152304468 PLN271 10 1152563723 PLN271 11 1040594205 PLN271 1 855200634 PLN271 1 820202995 PLN271 1 805441917 PLN271 1 771724241 PLN271 1 762070625 PLN271 1 751169182 PLN271 1 750359204 PLN272 1 899925126 PLN272 1 744247545 PLN272 1 734040163 PLN272 1 727768223 PLN272 1 706380543 PLN272 1 697440629 PLN272 1 657106680 PLN272 1 652311491 PLN272 1 644076382 PLN272 1 626530690 PLN272 2 1181567311 PLN273 4283 1114988573 PLN273 2 1048701616 PLN273 32 1180535226 PLN273 59 1154285521 PLN273 31 1154120145 PLN273 104 1055365244 PLN273 15 1048106591 PLN273 9 1012333527 PLN273 3 954912184 PLN273 4 964508173 PLN273 3 943820987 PLN274 790 778357973 PLN274 4 1116063982 PLN274 20 1144176226 PLN274 12 1114894013 PLN274 12 1137823694 PLN274 12 1163882746 PLN274 12 1115238429 PLN274 12 1122563814 PLN274 12 1136421313 PLN274 12 1145844303 PLN274 12 1107082534 PLN275 1 541700351 PLN275 12 1142512836 PLN275 12 1125312056 PLN275 12 1139937323 PLN275 12 1182207680 PLN275 13 1141632236 PLN275 13 1176626819 PLN275 12 1105901641 PLN275 12 1128486813 PLN275 12 1115719395 PLN275 12 1093314498 PLN276 1 696809892 PLN276 12 1135932077 PLN276 12 1113016681 PLN276 12 1133054034 PLN276 12 1162470007 PLN276 12 1128303196 PLN276 12 1128181967 PLN276 12 1130320861 PLN276 12 1167837959 PLN276 12 1095327503 PLN276 12 1125682167 PLN277 1 655542733 PLN277 12 1136256256 PLN277 12 1126388994 PLN277 12 1132848785 PLN277 12 1119156485 PLN277 12 1128690447 PLN277 12 1143255445 PLN277 12 1119226442 PLN277 12 1157473550 PLN277 12 1132476230 PLN277 12 1118260383 PLN278 1 648987779 PLN278 12 1118103996 PLN278 12 1131978048 PLN278 23 1015132058 PLN278 16 1038086816 PLN278 20 1060065520 PLN278 58 1117194557 PLN278 20 1168015791 PLN278 35 904945860 PLN278 3 938132596 PLN278 11 1166336107 PLN279 1 622068216 PLN279 33 1171831537 PLN279 44 1147849745 PLN279 59 1176455797 PLN279 46 1108150547 PLN279 18 1163482490 PLN279 52 1162314632 PLN279 32 1091266547 PLN279 9 982521871 PLN279 1 851108081 PLN279 5 1157583050 PLN28 69 1178437763 PLN280 1 583456046 PLN280 34 1173906692 PLN280 57 1168965653 PLN280 76 1161910677 PLN280 66 1162509837 PLN280 69 1174795302 PLN280 72 1077896066 PLN280 35 1114242636 PLN280 40 1174868272 PLN280 20 1084421845 PLN280 32 1114348613 PLN281 132 1176770373 PLN281 24 1173401278 PLN281 53 1170897023 PLN281 67 1142439659 PLN281 57 1176789337 PLN281 13 804026910 PLN281 2 849083094 PLN281 2 827072777 PLN281 2 813808502 PLN281 3 1125291465 PLN281 94 1165220936 PLN282 1 675310294 PLN282 56 1150288578 PLN282 13 1142345302 PLN282 45 1164304336 PLN282 50 1176882751 PLN282 71 1088127443 PLN282 26 1037221481 PLN282 21 1109199257 PLN282 11 1073959593 PLN282 11 1107354777 PLN282 11 1119391820 PLN283 1 628753756 PLN283 52 1159486455 PLN283 45 1149837585 PLN283 37 1176194222 PLN283 25 1132411027 PLN283 48 1180193812 PLN283 51 1145404441 PLN283 47 1177085945 PLN283 10 990082870 PLN283 3 950549487 PLN283 26 1179090526 PLN284 1 624247919 PLN284 48 1150937496 PLN284 34 1149366260 PLN284 220 1174868388 PLN284 34 1145347167 PLN284 44 1174931049 PLN284 46 1165666641 PLN284 48 1182988223 PLN284 68 1182873523 PLN284 40 1172192471 PLN284 50 1174377556 PLN285 2 1172266179 PLN285 62 1168965525 PLN285 108 1150187114 PLN285 23 1170492357 PLN285 56 1157171402 PLN285 46 1154636600 PLN285 37 1050873306 PLN285 7 1056657982 PLN285 25 1150798137 PLN285 59 1171753224 PLN285 13 178740122 PLN286 345 729691402 PLN286 1 1126997198 PLN286 1 1021039986 PLN286 1 913689924 PLN286 1 813615332 PLN286 1 794029244 PLN286 1 654336183 PLN286 2 1091555140 PLN286 13 1101442715 PLN286 24 1162366380 PLN286 3 632514185 PLN287 1 521073757 PLN287 1 704924984 PLN287 1 488827350 PLN287 1 786902218 PLN287 1 788253154 PLN287 1 656996469 PLN287 1 754526764 PLN287 1 838143122 PLN287 1 614052544 PLN287 1 745194924 PLN287 1 684220944 PLN288 1 672273650 PLN288 1 530082759 PLN288 1 704779586 PLN288 1 719760596 PLN288 2 1175392606 PLN288 1 704387883 PLN288 1 503782441 PLN288 1 747130668 PLN288 1 748735989 PLN288 78 1134618686 PLN288 98 1164594683 PLN289 1 634137895 PLN289 90 1179939353 PLN289 184 1121317734 PLN289 4 980506904 PLN289 9 1143778759 PLN289 24 1156230263 PLN289 114 1180061619 PLN289 27 547666509 PLN289 1 1023258579 PLN289 1 1022806109 PLN289 1 790103739 PLN29 11 1158106027 PLN290 1 624121443 PLN290 1 779251166 PLN290 1 750005036 PLN290 1 709723331 PLN290 1 694342408 PLN290 1 677352792 PLN290 1 673593976 PLN290 1 601234181 PLN290 2 1180642418 PLN290 2 1137198094 PLN290 2 1122266373 PLN291 2 1171800569 PLN291 2 1007930576 PLN291 2 932152498 PLN291 2 877608672 PLN291 94 1170293964 PLN291 72 1103472913 PLN291 30 1102625245 PLN291 15 1055514959 PLN291 8 1100878244 PLN291 13 911998996 PLN291 3 1123422797 PLN292 2 1153005584 PLN292 3 979813205 PLN292 4 1178105700 PLN292 10 1147166832 PLN292 49 1153179921 PLN292 68 1061569260 PLN292 4 1080819624 PLN292 59 776472596 PLN292 2 1057629540 PLN292 3 1049750696 PLN292 2 898000506 PLN293 1 661076038 PLN293 2 923099427 PLN293 5 917367996 PLN293 2 1104537567 PLN293 2 828367209 PLN293 34 1168300024 PLN293 9 969908863 PLN293 5 1128343623 PLN293 47 1161250923 PLN293 114 1072235648 PLN293 20 1173957616 PLN294 1 626572591 PLN294 52 1166159526 PLN294 37 1036175807 PLN294 19 1181394782 PLN294 56 1133566705 PLN294 12 1080406437 PLN294 21 711349390 PLN294 1 591539684 PLN294 1 710799132 PLN294 1 792318636 PLN294 1 823932343 PLN295 1 612852138 PLN295 1 760338934 PLN295 1 854699055 PLN295 1 761051754 PLN295 1 700867320 PLN295 1 716263619 PLN295 1 734793118 PLN295 1 625254178 PLN295 1 719649108 PLN295 1 744337004 PLN295 23 1164789123 PLN296 2 1169525711 PLN296 62 983177457 PLN296 1 460370126 PLN296 1 655396199 PLN296 1 578455667 PLN296 2 1062685698 PLN296 2 1091957499 PLN296 33 1165922690 PLN296 113 1137953023 PLN296 74 1163981699 PLN296 34 1163212681 PLN297 2 1136827172 PLN297 43 1165127781 PLN297 113 1160057195 PLN297 19 1101163362 PLN297 23 1140337494 PLN297 172 1037443049 PLN297 32 1146008755 PLN297 19 525399639 PLN297 1 1054177117 PLN297 1 992128384 PLN297 1 984531865 PLN298 1 653624577 PLN298 1 967396631 PLN298 1 954953679 PLN298 1 928741930 PLN298 1 830434546 PLN298 1 804029430 PLN298 1 784014605 PLN298 1 737318318 PLN298 3 1152192646 PLN298 30 1081073437 PLN298 57 1130542778 PLN299 1 616219606 PLN299 38 1135047684 PLN299 26 1139353359 PLN299 20 671397491 PLN299 1 1034352546 PLN299 1 979043460 PLN299 1 958700079 PLN299 1 926990439 PLN299 1 943939344 PLN299 1 903580599 PLN299 1 794192841 PLN3 139621 750781698 PLN30 4 1019989148 PLN300 1 610044819 PLN300 1 794114921 PLN300 1 769578336 PLN300 1 704953917 PLN300 20 1178045683 PLN300 54 1175726175 PLN300 64 1161338605 PLN300 56 1173620997 PLN300 38 850095504 PLN300 3 1028972525 PLN300 3 968884310 PLN301 2 1134152592 PLN301 42900 1070767877 PLN301 147497 768469902 PLN301 149795 779785278 PLN301 200157 715523263 PLN301 157743 795335194 PLN301 71876 217916929 PLN302 2 1156707404 PLN303 1 685423969 PLN304 1 640667275 PLN305 1 639123876 PLN306 1 612949391 PLN307 1 577192767 PLN308 2 1141642242 PLN309 1 648922534 PLN31 452 1172100458 PLN310 1 604770208 PLN311 2 1173859433 PLN312 2 1159392798 PLN313 2 1164574848 PLN314 1 615767531 PLN315 1 605571303 PLN316 2 1142007082 PLN317 4 1166534982 PLN318 1 710194481 PLN319 1 661081403 PLN32 307 1126350236 PLN320 1 659460550 PLN321 1 630572514 PLN322 1 598618390 PLN323 1 658974642 PLN324 1 559656399 PLN325 1 717517502 PLN326 1 672450454 PLN327 1 665297378 PLN328 1 636785599 PLN329 1 599706080 PLN33 181 1061633356 PLN330 1 675658265 PLN331 1 523168208 PLN332 1 671211297 PLN333 1 630677708 PLN334 1 623428415 PLN335 2 1162824663 PLN336 2 1124081839 PLN337 1 640830439 PLN338 1 597781253 PLN339 2 1170541913 PLN34 269714 717336209 PLN340 2 1151597807 PLN341 1 537457279 PLN342 1 685947972 PLN343 1 649921694 PLN344 1 641099225 PLN345 1 611845738 PLN346 1 581041262 PLN347 2 1176958498 PLN348 1 667717957 PLN349 1 631819663 PLN35 49314 700300355 PLN350 1 624692602 PLN351 2 1159089013 PLN352 2 1154165677 PLN353 1 670202054 PLN354 1 631946783 PLN355 1 626743494 PLN356 2 1167772850 PLN357 2 1151941538 PLN358 1 671530377 PLN359 1 631910401 PLN36 965 789195631 PLN360 1 622474059 PLN361 2 1160377439 PLN362 2 1159528938 PLN363 1 684336246 PLN364 1 636053469 PLN365 1 629969872 PLN366 2 1172688001 PLN367 2 1160045407 PLN368 1 665715246 PLN369 1 624683667 PLN37 1175 1107665303 PLN370 1 621078253 PLN371 2 1159864294 PLN372 2 1170185454 PLN373 1 697540743 PLN374 1 655862368 PLN375 1 646765634 PLN376 1 618540729 PLN377 1 587963859 PLN378 455 1147653963 PLN379 31 909553549 PLN38 235 1110225324 PLN380 1 705338699 PLN381 1 493450010 PLN382 1 804285258 PLN383 1 810734643 PLN384 1 673981989 PLN385 1 754496630 PLN386 1 855759449 PLN387 1 614042580 PLN388 1 743847818 PLN389 1 673340788 PLN39 473 1092198196 PLN390 1 515668560 PLN391 1 713320806 PLN392 1 703598484 PLN393 1 570159854 PLN394 1 625793224 PLN395 1 721110502 PLN396 1 459355444 PLN397 1 745201001 PLN398 1 749284433 PLN399 1 643344672 PLN4 30466 958178313 PLN40 41 1136094740 PLN400 1 595297365 PLN401 1 688905267 PLN402 1 491807393 PLN403 1 769338634 PLN404 1 671568023 PLN405 1 635285330 PLN406 1 745618965 PLN407 1 839470345 PLN408 1 646400022 PLN409 1 747589525 PLN41 120 1169030450 PLN410 2 1171764895 PLN411 1 703962928 PLN412 1 702438406 PLN413 2 1178978634 PLN414 2 1173154747 PLN415 1 734536914 PLN416 1 738743901 PLN417 1 636778132 PLN418 1 602900890 PLN419 1 697493198 PLN42 153 1076249108 PLN420 1 490518203 PLN421 1 784661008 PLN422 1 810500911 PLN423 1 655314739 PLN424 1 752710991 PLN425 1 890847171 PLN426 1 621781073 PLN427 1 743084022 PLN428 1 676741658 PLN429 1 509452426 PLN43 9 1018442629 PLN430 1 710124532 PLN431 2 1058788934 PLN432 1 620140791 PLN433 1 716573881 PLN434 1 476726550 PLN435 1 756324664 PLN436 1 977471539 PLN437 2 1144819353 PLN438 1 646234737 PLN439 1 605172934 PLN44 49 1134143683 PLN440 2 1165717241 PLN441 2 1153140076 PLN442 1 590561804 PLN443 2 1176631761 PLN444 1 782694893 PLN445 1 796420183 PLN446 1 650274702 PLN447 1 739889549 PLN448 1 848590828 PLN449 1 610626473 PLN45 42 1144813908 PLN450 1 738023571 PLN451 2 1173882462 PLN452 1 701434008 PLN453 1 690770133 PLN454 1 567265955 PLN455 1 612987783 PLN456 1 704156067 PLN457 1 475327881 PLN458 1 732118298 PLN459 1 733931846 PLN46 166 1153823107 PLN460 1 636796232 PLN461 1 599764323 PLN462 1 691313424 PLN463 1 493357854 PLN464 1 782685093 PLN465 1 786410271 PLN466 1 648139033 PLN467 1 744407562 PLN468 1 835583350 PLN469 1 623221719 PLN47 111 1067421254 PLN470 1 741299132 PLN471 1 669032550 PLN472 1 517040482 PLN473 1 711661679 PLN474 1 708205786 PLN475 2 1156892395 PLN476 2 1178356817 PLN477 1 737453356 PLN478 1 736349413 PLN479 1 639162162 PLN48 338 994170862 PLN480 1 586755746 PLN481 1 704478343 PLN482 1 492109999 PLN483 1 791475352 PLN484 1 785940626 PLN485 1 661246824 PLN486 1 756990402 PLN487 1 858776195 PLN488 1 621195942 PLN489 1 754256086 PLN49 18 1062075169 PLN490 1 670301833 PLN491 1 509263899 PLN492 1 708234589 PLN493 1 725120110 PLN494 1 575129590 PLN495 1 620883766 PLN496 1 727285804 PLN497 1 479660269 PLN498 1 745978486 PLN499 1 750160716 PLN5 4402 1036283513 PLN50 32 1014610802 PLN500 1 642428577 PLN501 1 591313643 PLN502 1 705330581 PLN503 1 495656580 PLN504 1 803232604 PLN505 1 790745243 PLN506 1 657494025 PLN507 1 759305888 PLN508 1 856542542 PLN509 1 628321883 PLN51 69 921693787 PLN510 1 754364263 PLN511 1 697113365 PLN512 1 504254270 PLN513 1 715354979 PLN514 1 713929667 PLN515 1 572943128 PLN516 1 626959190 PLN517 1 715714221 PLN518 1 483823121 PLN519 1 742917797 PLN52 4 1109791911 PLN520 1 748536659 PLN521 1 643784981 PLN522 1 600654286 PLN523 2 1171400808 PLN524 1 794150360 PLN525 1 799857935 PLN526 1 655329108 PLN527 1 749763888 PLN528 1 838116175 PLN529 1 610468321 PLN53 73 1067150263 PLN530 1 736551279 PLN531 2 1171154657 PLN532 2 1170482349 PLN533 1 566465558 PLN534 1 614421429 PLN535 2 1179310235 PLN536 1 735408736 PLN537 1 969998116 PLN538 11 635028102 PLN539 1 595339094 PLN54 8 1141528275 PLN540 1 698605642 PLN541 1 499102108 PLN542 1 791748890 PLN543 1 797311483 PLN544 1 656817438 PLN545 1 753360318 PLN546 1 845838138 PLN547 1 619661694 PLN548 1 752772853 PLN549 1 689709469 PLN55 184 1170332002 PLN550 1 509595892 PLN551 1 712797596 PLN552 1 710493282 PLN553 1 570643040 PLN554 1 619886155 PLN555 1 705533140 PLN556 1 484551304 PLN557 1 740148362 PLN558 1 757233630 PLN559 1 642499559 PLN56 57 1143524148 PLN560 1 594006513 PLN561 1 693261537 PLN562 1 492948387 PLN563 1 781462734 PLN564 1 802944975 PLN565 1 650275864 PLN566 1 756841830 PLN567 1 850623622 PLN568 1 614136911 PLN569 1 723255126 PLN57 46 1080435469 PLN570 2 1177410070 PLN571 1 712168462 PLN572 1 712339524 PLN573 1 564869106 PLN574 1 619418949 PLN575 1 715454519 PLN576 1 478264344 PLN577 1 734693445 PLN578 1 749685439 PLN579 14 1101365435 PLN58 79 1110750483 PLN580 1 782818162 PLN581 1 1022071454 PLN582 1 971920087 PLN583 1 827198496 PLN584 1 867619200 PLN585 1 806566123 PLN586 1 1015700474 PLN587 1 742303966 PLN588 1 956173857 PLN589 1 916702776 PLN59 98 1116925162 PLN590 1 874517040 PLN591 1 816294110 PLN592 1 750216944 PLN593 196 1003376355 PLN594 2 1182091663 PLN595 1 621516506 PLN596 1 610333535 PLN597 2 1150013201 PLN598 120 946417647 PLN599 5 1140594043 PLN6 84 1095629617 PLN60 448 1055011679 PLN600 773 1136041142 PLN601 18 958385885 PLN602 3 1008669690 PLN603 27314 1072986454 PLN604 2028 954547119 PLN605 1 594102056 PLN606 1 689851870 PLN607 1 495453186 PLN608 1 780798557 PLN609 1 801256715 PLN61 398 1027151193 PLN610 1 651852609 PLN611 1 750843639 PLN612 1 830829764 PLN613 1 615552423 PLN614 1 744588157 PLN615 1 673617499 PLN616 1 509857067 PLN617 1 709773743 PLN618 1 713149757 PLN619 1 566080677 PLN62 287 1138375171 PLN620 1 618079260 PLN621 1 720988478 PLN622 1 473592718 PLN623 1 736706236 PLN624 1 750620385 PLN625 2571 1146358435 PLN626 19714 976433542 PLN627 1 585266722 PLN628 1 681112512 PLN629 1 775448786 PLN63 340 1172043416 PLN630 1 790338525 PLN631 1 746673839 PLN632 1 836514780 PLN633 1 736872137 PLN634 1 676292951 PLN635 1 669155517 PLN636 1 701372996 PLN637 1 615672275 PLN638 1 698614761 PLN639 1 728031845 PLN64 140 1116887859 PLN640 134473 917882702 PLN641 273379 596178853 PLN642 305651 565578839 PLN643 244229 638944658 PLN644 209061 670853294 PLN645 167862 730248131 PLN646 173034 724950212 PLN647 155177 757616861 PLN648 175261 722501877 PLN649 162162 738844183 PLN65 390 1057868185 PLN650 122309 801644465 PLN651 180094 752468489 PLN652 150774 769652943 PLN653 160528 737908758 PLN654 3737 640222897 PLN655 1 528447123 PLN656 1 678170541 PLN657 1 639558213 PLN658 1 629672760 PLN659 2 1174163216 PLN66 146 1146378913 PLN660 2 1166970321 PLN661 1 684376481 PLN662 1 642597466 PLN663 1 631979072 PLN664 1 607115911 PLN665 1 582960187 PLN666 1 640026769 PLN667 1 608979116 PLN668 1 720972993 PLN669 1 501257520 PLN67 433 1130805376 PLN670 1 804602427 PLN671 1 808121247 PLN672 1 649118519 PLN673 1 758906661 PLN674 1 861141126 PLN675 1 642382296 PLN676 1 759893476 PLN677 1 689766370 PLN678 1 531462149 PLN679 1 714517032 PLN68 116 1106702539 PLN680 1 717288350 PLN681 1 586345039 PLN682 1 626266972 PLN683 1 738085275 PLN684 1 505809789 PLN685 1 759124079 PLN686 1 751612808 PLN687 12 1160338339 PLN688 685 1037884752 PLN689 2 1145861525 PLN69 145 1145833374 PLN690 2 1112884977 PLN691 2 941790226 PLN692 2 872653306 PLN693 2 944711370 PLN694 2 896921305 PLN695 2 1009490414 PLN696 2 973761421 PLN697 2 1028906041 PLN698 2 1128101800 PLN699 1 596326505 PLN7 175 1160007531 PLN70 109 1128758671 PLN700 1 634542603 PLN701 1 739379263 PLN702 1 641549888 PLN703 1 641159025 PLN704 2 1084467808 PLN705 2 1066659823 PLN706 2 1003274506 PLN707 2 851716800 PLN708 2 995026189 PLN709 2 869378871 PLN71 29 1139856467 PLN710 2 922541915 PLN711 2 917029648 PLN712 2 1113527553 PLN713 1 667652801 PLN714 2 1153333809 PLN715 2 976557482 PLN716 2 971318115 PLN717 2 905021021 PLN718 2 779060037 PLN719 2 1026993414 PLN72 10 1117587384 PLN720 2 1040398764 PLN721 2 906287378 PLN722 2 1107801300 PLN723 2 1085890887 PLN724 2 1048094875 PLN725 2 1011185181 PLN726 2 1092181461 PLN727 2 1026383973 PLN728 2 1018992133 PLN729 21 1150858229 PLN73 10 1148554513 PLN730 1 794474755 PLN731 1 760111594 PLN732 1 769810128 PLN733 1 715684684 PLN734 1 623890083 PLN735 1 755457679 PLN736 1 717109572 PLN737 1 817712742 PLN738 1 864624966 PLN739 1 701857263 PLN74 9 1120796302 PLN740 1 726425509 PLN741 1 738041677 PLN742 1 767912069 PLN743 2 1167186906 PLN744 2 1167934623 PLN745 2 1091547167 PLN746 3 1082389428 PLN747 4 1174948639 PLN748 3 1022191755 PLN749 320 1104176749 PLN75 7 1026172545 PLN750 142 1040534860 PLN751 403 1143989685 PLN752 25 965865578 PLN753 2 1083817966 PLN754 2 1135086767 PLN755 2 1031765593 PLN756 149 1154467731 PLN757 31 1157770692 PLN758 1045 845678948 PLN759 1 703076930 PLN76 6 1048682201 PLN760 1 495911329 PLN761 1 796169439 PLN762 1 779372321 PLN763 1 665561653 PLN764 1 757165295 PLN765 1 852704148 PLN766 1 623698249 PLN767 1 745048881 PLN768 1 677947850 PLN769 1 524289323 PLN77 121 1082020833 PLN770 1 726838826 PLN771 1 701430346 PLN772 1 584133940 PLN773 1 622677745 PLN774 1 745712656 PLN775 1 490622797 PLN776 1 748850018 PLN777 1 753856519 PLN778 700 674126380 PLN779 1 593930347 PLN78 194 1147708786 PLN780 1 702775664 PLN781 1 494594617 PLN782 1 792837209 PLN783 1 812232696 PLN784 1 661835603 PLN785 1 750337041 PLN786 1 854463248 PLN787 1 623248023 PLN788 1 749950614 PLN789 1 673746810 PLN79 62 1172590034 PLN790 1 520815567 PLN791 1 712547961 PLN792 1 703299309 PLN793 1 569771178 PLN794 1 620176429 PLN795 1 717542863 PLN796 1 493761083 PLN797 1 746502734 PLN798 1 752612656 PLN799 573 686952725 PLN8 11 1122979570 PLN80 5 1082425347 PLN800 2 990024350 PLN801 2 888868060 PLN802 2 933784370 PLN803 2 956308001 PLN804 1 589118817 PLN805 1 638425132 PLN806 1 716105986 PLN807 1 613160974 PLN808 2 1177939381 PLN809 2 1016319037 PLN81 45 1166491229 PLN810 2 936303591 PLN811 2 797242864 PLN812 242 1168816031 PLN813 442 902950534 PLN814 1 593930347 PLN815 1 702775664 PLN816 1 494594617 PLN817 1 792837209 PLN818 1 812232696 PLN819 1 661835603 PLN82 334 970680337 PLN820 1 750337041 PLN821 1 854463248 PLN822 1 623248023 PLN823 1 749950614 PLN824 1 673746810 PLN825 1 520815567 PLN826 1 712547961 PLN827 1 703299309 PLN828 1 569771178 PLN829 1 620176429 PLN83 39 1128799885 PLN830 1 717542863 PLN831 1 493761083 PLN832 1 746502734 PLN833 1 752612656 PLN834 233 1180834457 PLN835 6503 509584943 PLN836 1 657893865 PLN837 2 1156686622 PLN838 2 1150914040 PLN839 380 1155145851 PLN84 8 1109447019 PLN840 59 1166081052 PLN841 42 1159685336 PLN842 64 1170728010 PLN843 42 1168248595 PLN844 43 1182686463 PLN845 34 1160973286 PLN846 40 1141073775 PLN847 22 1158196445 PLN848 39 1163413684 PLN849 1539 1070673887 PLN85 5 1059002120 PLN850 29 1141110474 PLN851 102 1109427475 PLN852 18 1136907998 PLN853 18 1120554374 PLN854 120 900994766 PLN855 2 966616357 PLN856 2 961231359 PLN857 2 959348670 PLN858 2 941888879 PLN859 2 992260537 PLN86 4 997915160 PLN860 2 960927598 PLN861 2 1085142698 PLN862 2 928574646 PLN863 2 960398985 PLN864 2 1011567918 PLN865 2 921710939 PLN866 2 976854485 PLN867 2 945131460 PLN868 2 1045294153 PLN869 2 1145349851 PLN87 4 976386315 PLN870 2 995015465 PLN871 2 950596361 PLN872 2 1169107166 PLN873 1 566030753 PLN874 1 701140916 PLN875 2 1155844490 PLN876 2 1088364007 PLN877 2 971070292 PLN878 2 1050853591 PLN879 2 948015595 PLN88 264 1176839642 PLN880 2 1031994025 PLN881 2 894692277 PLN882 2 956934777 PLN883 2 893104175 PLN884 1 591388374 PLN885 1 642829877 PLN886 1 720427542 PLN887 1 619021063 PLN888 2 1169278607 PLN889 2 1025891263 PLN89 27 1085446047 PLN890 2 923969239 PLN891 2 807416841 PLN892 2 1033377508 PLN893 2 887724107 PLN894 2 999522382 PLN895 2 849465503 PLN896 2 1041854786 PLN897 1 636463470 PLN898 1 714328599 PLN899 1 612958257 PLN9 4 948160392 PLN90 9 958724654 PLN900 2 1178299787 PLN901 2 1007094188 PLN902 2 866165270 PLN903 2 777175039 PLN904 2 802708210 PLN905 2 890769199 PLN906 2 982975491 PLN907 2 915035289 PLN908 1 707005220 PLN909 1 578675767 PLN91 2 1174734371 PLN910 1 630106688 PLN911 1 727725115 PLN912 1 613808757 PLN913 2 1179609774 PLN914 2 1009854848 PLN915 2 917808850 PLN916 2 790148711 PLN917 2 1032220636 PLN918 2 894501712 PLN919 2 985888097 PLN92 2 1111268940 PLN920 2 926569722 PLN921 2 1063086128 PLN922 1 637454632 PLN923 1 724254532 PLN924 1 613944685 PLN925 2 1170940412 PLN926 2 993964367 PLN927 2 880385638 PLN928 2 781232444 PLN929 2 911248131 PLN93 28 1135832320 PLN930 2 869861709 PLN931 2 996636965 PLN932 2 864240653 PLN933 2 1169165798 PLN934 1 647472272 PLN935 1 706733364 PLN936 1 614085230 PLN937 1 635422747 PLN938 2 1019261998 PLN939 2 958080401 PLN94 61 1175125979 PLN940 2 894843222 PLN941 2 801228751 PLN942 2 1017226017 PLN943 2 924320768 PLN944 2 937820667 PLN945 2 954225382 PLN946 1 588804097 PLN947 1 645230212 PLN948 1 729141937 PLN949 1 615797709 PLN95 35 1174553304 PLN950 2 1182456509 PLN951 2 1015568427 PLN952 2 902395658 PLN953 2 798230390 PLN954 2 1046699548 PLN955 2 892067234 PLN956 2 1004595350 PLN957 2 944104307 PLN958 2 1052511800 PLN959 1 646632339 PLN96 55 1140220569 PLN960 1 704200390 PLN961 1 613801794 PLN962 2 1183340258 PLN963 2 1003064818 PLN964 2 892759897 PLN965 2 795273472 PLN966 2 1047430050 PLN967 2 911102791 PLN968 2 987037057 PLN969 2 875672414 PLN97 69 1174500154 PLN970 2 1027343008 PLN971 1 641417984 PLN972 1 726119638 PLN973 1 613852582 PLN974 2 1175636351 PLN975 2 993484736 PLN976 2 864254712 PLN977 2 788159625 PLN978 2 1041727629 PLN979 2 906601356 PLN98 84 1092061528 PLN980 2 992779862 PLN981 2 927669836 PLN982 2 1030748629 PLN983 1 644315802 PLN984 1 730103899 PLN985 1 613255133 PLN986 1 638201570 PLN987 2 1029112597 PLN988 2 1007666115 PLN989 2 918118180 PLN99 17 1179161386 PLN990 2 769136577 PLN991 2 1013367739 PLN992 2 916753119 PLN993 2 936880916 PLN994 2 872095809 PLN995 1 571213658 PLN996 1 635113520 PLN997 1 720198412 PLN998 1 610332845 PLN999 2 1175952957 PRI1 51161 1002824769 PRI10 13 1100500214 PRI11 7 1032781085 PRI12 5 1067810412 PRI13 9 1180671468 PRI14 8 1107000153 PRI15 11 1174619811 PRI16 6 1064076226 PRI17 11 1177365167 PRI18 11 1103395128 PRI19 8 1081303381 PRI2 7910 1072145329 PRI20 6 1136611601 PRI21 225206 749806845 PRI22 177395 651440069 PRI23 114357 848937091 PRI24 160100 708047587 PRI25 79775 975948715 PRI26 739 1177886289 PRI27 38926 1088189168 PRI28 70856 245718363 PRI3 7901 1132972500 PRI4 10360 1160614863 PRI5 152425 840442381 PRI6 19989 1008567045 PRI7 6 1137401032 PRI8 10 1163372937 PRI9 114467 822454647 ROD1 42166 1008846461 ROD10 9 1120040541 ROD100 12 1154027383 ROD101 12 1029308627 ROD102 8 1139757719 ROD103 9 1174668373 ROD104 7 1067359328 ROD105 10 1182029473 ROD106 4 959918585 ROD107 6 1044932681 ROD108 68 1124872912 ROD109 10 1133876088 ROD11 8 1167428371 ROD110 19 1182564383 ROD111 10 1092721418 ROD112 16 1182453566 ROD113 12 1081345329 ROD114 9 1086039483 ROD115 7 934030466 ROD116 3 957465392 ROD117 475 1048189547 ROD118 6 1165862858 ROD119 12 1183628894 ROD12 162 1108579006 ROD120 1267 1077487382 ROD121 13 1180218841 ROD122 12 1002040584 ROD123 4 1104451519 ROD124 7 1129295234 ROD125 3 943537218 ROD126 5 1075819157 ROD127 54053 794974708 ROD13 8 1139650847 ROD14 89 1070948417 ROD15 10 1111521830 ROD16 15 1178694588 ROD17 17 1166281652 ROD18 100137 944804294 ROD19 8 1182185222 ROD2 5909 1093927363 ROD20 11 979969464 ROD21 8 1173820524 ROD22 11 977041837 ROD23 7 1065740602 ROD24 110 1130872454 ROD25 10 1095487923 ROD26 8 1173337133 ROD27 8 1063713588 ROD28 9 1146396098 ROD29 10 1068290457 ROD3 6339 1107756976 ROD30 8 1081733625 ROD31 11 1082140969 ROD32 10 1147232155 ROD33 10 1171959357 ROD34 7 1110074623 ROD35 10 1164218519 ROD36 9 1108644203 ROD37 8 1072581452 ROD38 10 1046751576 ROD39 8 1141423843 ROD4 110072 874896894 ROD40 11 1027724205 ROD41 10 1152345994 ROD42 8 1082920857 ROD43 8 1089063230 ROD44 9 1143097394 ROD45 10 1072150743 ROD46 8 1099764473 ROD47 11 1087836125 ROD48 8 1171715672 ROD49 12 1136130400 ROD5 299 1168021186 ROD50 7 1113098900 ROD51 10 1162104909 ROD52 9 1083630069 ROD53 9 1170482326 ROD54 11 1099809287 ROD55 10 1145640092 ROD56 9 1132503232 ROD57 10 1140056814 ROD58 19 1075143845 ROD59 10 1147351773 ROD6 771 1169858159 ROD60 19 1151436343 ROD61 10 1088581837 ROD62 16 1164391722 ROD63 12 1073032075 ROD64 9 1157194591 ROD65 14 1023016171 ROD66 7 1166266691 ROD67 9 1087901740 ROD68 9 1097713367 ROD69 9 1154691504 ROD7 368225 531451727 ROD70 9 1025612394 ROD71 7 1082392531 ROD72 10 1140331137 ROD73 9 1166871002 ROD74 14 1168528777 ROD75 8 1126440038 ROD76 12 1149086196 ROD77 10 1051885153 ROD78 12 1161926762 ROD79 11 1086828534 ROD8 6 1053651819 ROD80 10 1148564844 ROD81 12 1022809212 ROD82 8 1104739191 ROD83 14 1038854127 ROD84 7 1113949024 ROD85 14 1147316566 ROD86 9 1098255843 ROD87 13 1183189045 ROD88 11 1140514852 ROD89 14 1175080086 ROD9 10 1151265120 ROD90 13 1051083644 ROD91 9 1156825032 ROD92 52 1118266047 ROD93 12 1173398982 ROD94 18 1154143271 ROD95 11 1123323681 ROD96 18 1080123782 ROD97 11 1146173548 ROD98 148 1098231299 ROD99 7 1166537123 STS1 422691 213726061 STS2 348926 243828001 STS3 575371 183369075 SYN1 54450 995654191 SYN10 20828 92889487 SYN2 10 1040305979 SYN3 6 1076407027 SYN4 9 1128400530 SYN5 10 1040305979 SYN6 6 1076407027 SYN7 306 907550246 SYN8 78026 858572691 SYN9 170141 758144055 TSA1 675597 274501312 TSA10 489925 443967286 TSA11 463510 475809110 TSA12 540749 380961310 TSA13 536121 386158290 TSA14 551403 397190613 TSA15 500839 391545865 TSA16 459820 346653669 TSA17 528361 429318912 TSA18 458131 491403635 TSA19 548247 448201305 TSA2 551956 321399573 TSA20 479565 355564467 TSA21 422760 350252472 TSA22 492241 418656157 TSA23 488692 427549888 TSA24 503249 446528864 TSA25 550699 412952673 TSA26 323340 596553368 TSA27 321541 523174783 TSA28 213200 239946602 TSA29 247751 86681348 TSA3 516307 398458241 TSA30 252812 64267185 TSA31 492147 400090357 TSA32 394508 539845615 TSA33 368043 575727277 TSA34 421692 476414941 TSA35 418657 478983656 TSA36 453568 411941442 TSA37 59565 38312043 TSA4 505746 416462204 TSA5 500738 360181483 TSA6 584781 316716329 TSA7 573372 365801982 TSA8 592278 269627634 TSA9 536897 421768430 UNA1 1084 4911630 VRL1 351083 454335611 VRL10 178547 681884597 VRL100 35611 648908821 VRL101 23542 659694583 VRL102 25834 661660635 VRL103 24613 666527592 VRL104 22761 659692409 VRL105 22880 663283496 VRL106 22499 662321289 VRL107 22666 664276940 VRL108 22881 662444262 VRL109 25129 658963854 VRL11 219797 549925465 VRL110 22676 664171862 VRL111 22776 661681000 VRL112 25442 662410951 VRL113 23481 663970139 VRL114 23955 664279590 VRL115 24624 662646942 VRL116 25363 662325650 VRL117 24603 670153995 VRL118 24550 665553449 VRL119 24199 666851064 VRL12 241949 532037102 VRL120 23953 667191377 VRL121 24230 666768446 VRL122 23611 665889314 VRL123 23321 669198537 VRL124 24181 665705085 VRL125 23519 664982846 VRL126 27388 661233418 VRL127 24801 663570535 VRL128 23333 666356388 VRL129 22610 661217830 VRL13 185428 556140063 VRL130 27193 660481885 VRL131 24247 664372885 VRL132 23551 667104862 VRL133 23453 665712192 VRL134 26947 665434089 VRL135 23204 663045047 VRL136 24713 665270255 VRL137 25817 662030596 VRL138 25871 667377444 VRL139 26207 669946579 VRL14 70677 648676511 VRL140 25943 661757017 VRL141 23757 667692209 VRL142 26399 661643285 VRL143 25675 664612317 VRL144 30299 655439840 VRL145 23724 663726555 VRL146 25117 663037795 VRL147 25506 664926522 VRL148 23125 665866148 VRL149 28973 664534462 VRL15 73261 637631503 VRL150 24859 663256717 VRL151 23979 666210670 VRL152 23462 669847681 VRL153 23835 668954639 VRL154 24971 669838309 VRL155 23108 670643943 VRL156 23808 673355943 VRL157 29535 658775753 VRL158 31392 661433798 VRL159 26238 667496185 VRL16 47439 656215161 VRL160 31694 659236674 VRL161 24648 670160543 VRL162 26120 666273839 VRL163 32198 658555603 VRL164 26158 659831131 VRL165 24923 665350915 VRL166 27961 663907127 VRL167 33338 655380829 VRL168 31292 656573506 VRL169 26048 665586037 VRL17 29997 662730165 VRL170 26906 669509937 VRL171 25939 676966620 VRL172 24522 677860055 VRL173 26563 662992369 VRL174 37295 654518356 VRL175 33070 670595878 VRL176 33217 664825539 VRL177 33291 662299059 VRL178 42666 660983117 VRL179 40101 657388517 VRL18 28496 664588085 VRL180 31742 672459431 VRL181 33604 668296721 VRL182 24714 666710116 VRL183 31938 664825067 VRL184 36525 664919208 VRL185 27420 666675929 VRL186 44714 655998344 VRL187 39539 662609568 VRL188 30842 665938861 VRL189 34794 904740949 VRL19 33123 658710693 VRL190 37178 1110844029 VRL191 37926 1131427784 VRL192 38077 1135008170 VRL193 37787 1127308843 VRL194 37589 1121572743 VRL195 37367 1115916896 VRL196 37222 1112056762 VRL197 37271 1113354286 VRL198 37147 1112672939 VRL199 36893 1101743178 VRL2 130970 578457354 VRL20 27309 660047159 VRL200 36976 1105046337 VRL201 37158 1109001046 VRL202 37043 1105978038 VRL203 37040 1106727719 VRL204 37213 1111323924 VRL205 37145 1109955881 VRL206 37088 1108131520 VRL207 37117 1109282715 VRL208 37062 1107573049 VRL209 37059 1107598287 VRL21 35735 653032291 VRL210 36245 1083276846 VRL211 37010 1105705855 VRL212 36994 1105325229 VRL213 37482 1118792697 VRL214 37277 1113291450 VRL215 37073 1107331452 VRL216 37127 1108459451 VRL217 36955 1104916824 VRL218 37366 1115740899 VRL219 37130 1109641545 VRL22 24046 660638096 VRL220 37410 1116124681 VRL221 37473 1118511961 VRL222 37195 1111170529 VRL223 36973 1104278526 VRL224 37438 1117094458 VRL225 37254 1112321593 VRL226 37167 1109812202 VRL227 37089 1107797132 VRL228 37276 1112804785 VRL229 37004 1105360859 VRL23 24068 662798030 VRL230 36907 1102551530 VRL231 37010 1105121661 VRL232 37295 1112585626 VRL233 37097 1107745360 VRL234 36996 1105123222 VRL235 37030 1106112900 VRL236 37102 1108317418 VRL237 37593 1118428833 VRL238 37192 1111003321 VRL239 37327 1115121039 VRL24 29503 658667417 VRL240 37057 1106758480 VRL241 37099 1107955381 VRL242 37166 1109790766 VRL243 37050 1106380117 VRL244 36645 1094361501 VRL245 37121 1108254509 VRL246 37125 1108285805 VRL247 37130 1108374075 VRL248 37214 1111025408 VRL249 37557 1119259029 VRL25 24914 662447322 VRL250 37483 1119444045 VRL251 37420 1117587996 VRL252 37167 1109809577 VRL253 37018 1105412831 VRL254 36371 1085590171 VRL255 36667 1094131671 VRL256 37866 1128491166 VRL257 37748 1125035969 VRL258 37990 1130190145 VRL259 37757 1124441431 VRL26 23776 664531048 VRL260 37912 1128316481 VRL261 37877 1128796883 VRL262 37508 1117834131 VRL263 38013 1131066116 VRL264 37544 1120524023 VRL265 37617 1125538963 VRL266 36845 1100254756 VRL267 37360 1110847770 VRL268 37590 1122665435 VRL269 37623 1123812638 VRL27 22935 664825214 VRL270 37633 1124039530 VRL271 37171 1110105984 VRL272 37375 1117731044 VRL273 37078 1111053757 VRL274 37442 1101292063 VRL275 38066 1096160759 VRL276 36433 1083283132 VRL277 35969 1074652475 VRL278 36359 1086519015 VRL279 36364 1086855045 VRL28 25416 663615413 VRL280 36384 1086616848 VRL281 36198 1081272460 VRL282 36548 1091515102 VRL283 36506 1089907079 VRL284 36535 1090739525 VRL285 36518 1090309966 VRL286 36515 1090222031 VRL287 36535 1090787428 VRL288 36774 1096711359 VRL289 37107 1105411556 VRL29 25913 663610817 VRL290 36803 1097960414 VRL291 37606 1118381351 VRL292 38167 1133049642 VRL293 38190 1133894794 VRL294 38123 1132378299 VRL295 38145 1132624223 VRL296 38158 1133191033 VRL297 38197 1134006068 VRL298 38501 1099113778 VRL299 36479 1089370419 VRL3 314022 426074606 VRL30 29231 666496811 VRL300 36577 1093035142 VRL301 36694 1096117301 VRL302 36621 1094021354 VRL303 36622 1094036670 VRL304 36614 1093797151 VRL305 36625 1094137452 VRL306 36245 1083068528 VRL307 36106 1076905412 VRL308 36157 1077111628 VRL309 36011 1068091324 VRL31 29397 665610029 VRL310 36962 1093116462 VRL311 37584 1122048535 VRL312 37519 1120602139 VRL313 36414 1088089944 VRL314 35861 1071479206 VRL315 36089 1078391118 VRL316 39190 1090854681 VRL317 39213 1094514281 VRL318 38755 1102476874 VRL319 36791 1105422503 VRL32 27584 664455240 VRL320 38944 1080667461 VRL321 26560 688070960 VRL322 29256 673237103 VRL323 33064 665708762 VRL324 31949 666119011 VRL325 46361 656953104 VRL326 55994 647938139 VRL327 29206 669087831 VRL328 73317 626662315 VRL329 64485 647532420 VRL33 26236 665200779 VRL330 39202 659246154 VRL331 33281 668411127 VRL332 46874 660749736 VRL333 37490 662480193 VRL334 40746 665497812 VRL335 78186 632638897 VRL336 26195 665513335 VRL337 26649 666032729 VRL338 114112 609525274 VRL339 119648 588891327 VRL34 23434 665911633 VRL340 97614 629185530 VRL341 136083 608053146 VRL342 98553 625361348 VRL343 102097 630776623 VRL344 131077 595315350 VRL345 5846 3959725 VRL35 26422 663725446 VRL36 22961 660186807 VRL37 23503 662606083 VRL38 23252 664074439 VRL39 24437 659723923 VRL4 278160 593940204 VRL40 30954 920767513 VRL41 37135 1110368759 VRL42 37141 1110176999 VRL43 37166 1110652424 VRL44 31147 928879008 VRL45 23611 665317160 VRL46 24389 665330292 VRL47 23011 659216980 VRL48 22493 658083776 VRL49 23346 664221823 VRL5 321704 471797024 VRL50 22806 660410346 VRL51 23155 663608614 VRL52 22804 663592380 VRL53 22598 660575207 VRL54 22757 664903006 VRL55 23893 667890047 VRL56 22707 660846172 VRL57 22943 666392261 VRL58 22875 664954567 VRL59 22374 661083510 VRL6 284168 465103621 VRL60 24680 666093430 VRL61 22718 661306950 VRL62 25273 669040025 VRL63 24367 666003237 VRL64 22288 660822018 VRL65 24235 668634575 VRL66 23287 665737572 VRL67 23554 662884825 VRL68 25534 663464585 VRL69 22335 661302942 VRL7 250539 510749036 VRL70 23143 665457305 VRL71 23365 665547378 VRL72 22341 662249208 VRL73 23293 667772423 VRL74 23793 664967200 VRL75 23240 664904171 VRL76 22910 665083714 VRL77 23017 661784586 VRL78 26147 664455178 VRL79 22357 665304955 VRL8 261756 492826154 VRL80 23167 664819913 VRL81 23084 665457472 VRL82 23050 667124575 VRL83 22955 663910665 VRL84 23282 664953453 VRL85 22462 663082132 VRL86 22390 666065579 VRL87 22783 667755213 VRL88 22625 661901956 VRL89 22658 673293508 VRL9 251216 522761777 VRL90 23243 666012223 VRL91 22396 664314116 VRL92 23277 665731916 VRL93 22768 668875018 VRL94 22885 661343657 VRL95 28303 672717545 VRL96 23320 665384180 VRL97 23132 663370245 VRL98 24794 664502660 VRL99 23672 661224092 VRT1 152024 879135700 VRT10 45 1135694700 VRT100 24 1178142842 VRT101 424 1176681910 VRT102 24 1180427118 VRT103 80 1130421596 VRT104 16 1165789377 VRT105 40 1177921443 VRT106 28 1100952301 VRT107 108 487838750 VRT108 2 806190538 VRT109 2 696540660 VRT11 46 1166153642 VRT110 4 904864528 VRT111 44 1019397561 VRT112 36 1178642032 VRT113 61 1042460441 VRT114 153 1133976286 VRT115 20 1151700990 VRT116 66 1177342711 VRT117 63 1011340213 VRT118 5 1114313003 VRT119 40 1121950258 VRT12 21 1154612277 VRT120 26 1165870027 VRT121 34 993803116 VRT122 10 863470745 VRT123 99 1055299498 VRT124 45 1173161375 VRT125 34 1154532236 VRT126 37 1165711270 VRT127 20 1174931749 VRT128 18 1153973849 VRT129 22 1182636590 VRT13 42 1138416806 VRT130 312 1171570949 VRT131 40 1165814453 VRT132 41 1170464824 VRT133 19 1155157253 VRT134 42 1177238185 VRT135 40 1181828030 VRT136 52 1166638748 VRT137 30 1154120422 VRT138 33 1094068098 VRT139 25 1160740832 VRT14 6 1071830967 VRT140 382 1158615012 VRT141 351 1031551398 VRT142 48 1177450183 VRT143 37 1168924425 VRT144 19 1164075103 VRT145 26 1182902339 VRT146 39 1133969144 VRT147 36 1168754407 VRT148 31 1163137436 VRT149 36 1170882423 VRT15 24 1114630108 VRT150 36 1152871582 VRT151 21 1177136033 VRT152 17 1131769706 VRT153 40 1099550703 VRT154 14 1151376722 VRT155 40 1181857143 VRT156 43 1118286302 VRT157 21 1172396618 VRT158 21 1159704045 VRT159 37 1180805679 VRT16 43 1073726915 VRT160 36 1074349268 VRT161 305 1147865056 VRT162 37 1155455580 VRT163 53 1170748576 VRT164 39 1042530955 VRT165 5 1145352964 VRT166 8 1166817677 VRT167 22 1099238862 VRT168 24 1181050320 VRT169 28 1128461858 VRT17 43 1181338879 VRT170 23 1179977145 VRT171 17 1140261904 VRT172 47 1162361489 VRT173 33 1082875689 VRT174 40 1155310889 VRT175 34 1151006005 VRT176 22 1099433063 VRT177 5 1056736991 VRT178 8 1141521528 VRT179 13 1130579885 VRT18 44 1174131351 VRT180 20 1160195610 VRT181 50 1171449262 VRT182 36 1181564440 VRT183 159 1113225433 VRT184 22 1003732213 VRT185 42 1170859841 VRT186 324 1076802826 VRT187 41 1138566252 VRT188 14 1179788972 VRT189 13 1137303478 VRT19 21 1125307855 VRT190 17 1162516663 VRT191 15 1104770266 VRT192 16 1019314169 VRT193 23 1178565343 VRT194 37 1182347574 VRT195 50 1134087574 VRT196 24 926554202 VRT197 4 1160654489 VRT198 6 1055180276 VRT199 11 1145381641 VRT2 30 1174650673 VRT20 30 1157895354 VRT200 18 1181285424 VRT201 15 1146666012 VRT202 27 1182848304 VRT203 21 1151141727 VRT204 16 1122899890 VRT205 42 1156993143 VRT206 18 1168032833 VRT207 24 1179938402 VRT208 27 1158754540 VRT209 31 1171954388 VRT21 29 1131545649 VRT210 14 1058831880 VRT211 7 1098198485 VRT212 10 1112454070 VRT213 21 982002519 VRT214 10 1173938281 VRT215 104 1176086894 VRT216 41 1179233542 VRT217 101 1118100577 VRT218 88 1113750674 VRT219 81 1105801281 VRT22 22528 1106721478 VRT220 39 1183798951 VRT221 67 1112995135 VRT222 35 905645556 VRT223 1 1377224146 VRT224 1 1246042375 VRT225 1 1134302525 VRT226 1 1092803421 VRT227 1 995116563 VRT228 1 979649957 VRT229 3 1100551194 VRT23 332846 636521199 VRT230 3 511216884 VRT231 1 1415942608 VRT232 1 1279781030 VRT233 1 1144564707 VRT234 1 1114117749 VRT235 1 1027171557 VRT236 1 998592877 VRT237 3 1103810273 VRT238 4 510174135 VRT239 1 1950672471 VRT24 100797 1008844576 VRT240 1 1882935974 VRT241 1 1702342136 VRT242 1 1361375652 VRT243 1 1317398316 VRT244 1 1293891082 VRT245 1 1269970046 VRT246 1 1248769876 VRT247 1 1238911699 VRT248 1 1201415365 VRT249 1 1199165587 VRT25 481309 416462758 VRT250 1 1184551933 VRT251 1 1183987023 VRT252 1 1134708421 VRT253 1 1024245046 VRT254 1 993383533 VRT255 3 1080922639 VRT256 39 1080538033 VRT257 42 1162049517 VRT258 43 1144321272 VRT259 19 1033892758 VRT26 475002 350745337 VRT260 8 1159899222 VRT261 12 1157225835 VRT262 19 1098867675 VRT263 15 1097791464 VRT264 18 1112130599 VRT265 34 1182680941 VRT266 17 1164381965 VRT267 34 1077194331 VRT268 34 1012246650 VRT269 33 1009704254 VRT27 533389 346483338 VRT270 8 201061856 VRT271 1 2146314909 VRT272 1 459926735 VRT273 1 2140055507 VRT274 1 526359502 VRT275 1 2132484007 VRT276 1 510744347 VRT277 1 2141402031 VRT278 1 154081089 VRT279 1 2143815925 VRT28 282483 683058087 VRT280 1 17068361 VRT281 1 2139332349 VRT282 1 1965638399 VRT283 1 1730884321 VRT284 1 1292683186 VRT285 1 1220333517 VRT286 1 1209226565 VRT287 7 1134997840 VRT288 26 1123273225 VRT289 25 1160795076 VRT29 211923 967533252 VRT290 6 147321427 VRT291 1 2144885605 VRT292 1 368539449 VRT293 1 2136077662 VRT294 1 338547956 VRT295 1 2137795666 VRT296 1 330263317 VRT297 1 2145962954 VRT298 1 25971532 VRT299 1 2035433746 VRT3 123 1174179528 VRT30 118039 1066217527 VRT300 1 1925992481 VRT301 1 1778043439 VRT302 1 1581089616 VRT303 1 1245844088 VRT304 1 1157923350 VRT305 1 1112128736 VRT306 5 1122801679 VRT307 11 1154196115 VRT308 44 1172047204 VRT309 24 1172348617 VRT31 13670 1145183541 VRT310 18 1176756695 VRT311 32 1112452156 VRT312 33 1117361619 VRT313 7 1120783487 VRT314 41 1174844090 VRT315 42 1137008278 VRT316 51 1132171300 VRT317 46 1155289000 VRT318 9 1153913320 VRT319 42 1117841999 VRT32 43 1145265916 VRT320 33 1162682117 VRT321 33 1173485746 VRT322 19 1150367348 VRT323 25 1160050164 VRT324 22 1007118500 VRT325 10 1163577529 VRT326 32 1111204722 VRT327 15 1160809883 VRT328 27 1176666881 VRT329 26 1174144085 VRT33 44 1183216035 VRT330 12 1126721375 VRT331 14 1136589921 VRT332 15 846410575 VRT333 5 1101265415 VRT334 23 1021791390 VRT335 1 896647653 VRT336 1 751834319 VRT337 1 688568912 VRT338 1 677924506 VRT339 2 898565348 VRT34 267 1181878602 VRT340 4 1121318331 VRT341 6 1111589716 VRT342 41 1164732652 VRT343 7 1146761244 VRT344 21 1066338465 VRT345 7 1134566935 VRT346 21 1068252028 VRT347 7 1133695910 VRT348 21 1068641290 VRT349 7 1139083692 VRT35 11 907316992 VRT350 22 1064139134 VRT351 7 1135127699 VRT352 21 1072078992 VRT353 7 1132643145 VRT354 22 1065553763 VRT355 41 1139882337 VRT356 41 1134645266 VRT357 7 1111229456 VRT358 21 1031013239 VRT359 7 1135497343 VRT36 4 1123547344 VRT360 22 1070839852 VRT361 7 1132117858 VRT362 21 1072202009 VRT363 7 1115661213 VRT364 25 1130603089 VRT365 34 1108251824 VRT366 33 1078433855 VRT367 32 1102576659 VRT368 33 1122931389 VRT369 36 1119127885 VRT37 6 1096697320 VRT370 26 1114623931 VRT371 14 1111480876 VRT372 35 1165025012 VRT373 46 1166464256 VRT374 41 1181636967 VRT375 50 1169898972 VRT376 43 1168305613 VRT377 23 1153777016 VRT378 41 1175702880 VRT379 22 1158457681 VRT38 20 1158617966 VRT380 39 964103972 VRT381 16 1100230459 VRT382 13 1127415560 VRT383 14 1098097097 VRT384 15 1058366566 VRT385 33 1019178663 VRT386 31 1121816640 VRT387 86 1112105249 VRT388 76 1040929698 VRT389 38 1170276073 VRT39 42 1176628400 VRT390 34 1162925051 VRT391 31 1172767250 VRT392 31 1156886919 VRT393 38 1182720999 VRT394 53 1146393333 VRT395 24 1183729642 VRT396 50 1109423527 VRT397 514 1154100595 VRT398 45 1095525668 VRT399 40 1152560715 VRT4 1793 1155890301 VRT40 39 827624945 VRT400 39 1155092592 VRT401 39 1157832228 VRT402 52 1164142881 VRT403 33 1171732718 VRT404 34 1175261758 VRT405 42 1176134268 VRT406 50 1177512077 VRT407 40 1161253321 VRT408 24 1077456323 VRT409 38 1157253319 VRT41 1 839681426 VRT410 40 1131884615 VRT411 41 1150776728 VRT412 24 955812464 VRT413 6 1172175453 VRT414 36 1106805370 VRT415 24 1096230448 VRT416 27 1179187804 VRT417 37 1141444096 VRT418 42 1111985416 VRT419 42 1077786431 VRT42 1 825560060 VRT420 44 1053936506 VRT421 41 1132655455 VRT422 65 1170505791 VRT423 36 1178590685 VRT424 33 1150096393 VRT425 25 1156665040 VRT426 10 1069508049 VRT427 16 1087774406 VRT428 30 983146377 VRT429 32 1083624474 VRT43 2 1082779519 VRT430 35 1090077145 VRT431 31 1026298488 VRT432 33 1102225181 VRT433 33 1116582366 VRT434 11 1133394429 VRT435 15 1155148012 VRT436 32 1142502069 VRT437 38 1150836579 VRT438 17 1092248824 VRT439 46 1175541046 VRT44 3 1072075408 VRT440 33 1038193136 VRT441 10 1139138727 VRT442 45 1169339467 VRT443 49 1180622820 VRT444 44 1163425555 VRT445 26 1099096908 VRT446 34 1163375282 VRT447 38 1125925834 VRT448 32 1082226694 VRT449 34 1093074174 VRT45 8 1112968075 VRT450 40 1110733248 VRT451 20 1121807002 VRT452 35 1165386724 VRT453 35 1056308023 VRT454 34 1144572371 VRT455 33 1117658537 VRT456 34 1153758089 VRT457 37 1151624199 VRT458 34 1082241263 VRT459 43 1085623466 VRT46 21 1180520471 VRT460 35 1066247769 VRT461 39 1049813295 VRT462 35 1077080590 VRT463 34 1020437335 VRT464 31 1134863906 VRT465 40 1089184257 VRT466 40 1184007820 VRT467 49 1136974067 VRT468 40 1112984161 VRT469 250 1137109495 VRT47 22 1158850226 VRT470 297 1074647444 VRT471 12 1167967380 VRT472 37 1153662634 VRT473 32 1130344516 VRT474 40 1107496915 VRT475 42 1137568399 VRT476 43 1107212078 VRT477 11 1129071028 VRT478 12 1133429631 VRT479 13 1173683913 VRT48 353 1181688611 VRT480 27 1170106733 VRT481 36 1171314437 VRT482 28 1179111099 VRT483 19 1061198244 VRT484 13 1144795237 VRT485 21 1096058209 VRT486 10 1142266842 VRT487 24 1017314423 VRT488 32 1145369866 VRT489 21 1179397471 VRT49 28 1098865212 VRT490 88 1157385574 VRT491 40 1166433573 VRT492 55 1165400846 VRT493 41 1159193888 VRT494 41 1175774290 VRT495 10 1180331923 VRT496 26 1169122579 VRT497 44 1168673098 VRT498 97 1150572035 VRT499 39 1182222455 VRT5 38 1178445140 VRT50 1 662004353 VRT500 29 924141939 VRT501 4 1141728015 VRT502 6 1140411517 VRT503 11 1135502151 VRT504 30 1170065794 VRT505 35 1164422714 VRT506 401 1176732502 VRT507 52 1181066843 VRT508 42 1183739699 VRT509 24 1153359990 VRT51 2 911653698 VRT510 25 1111515846 VRT511 41 1161106123 VRT512 58 1181526702 VRT513 38 1156582244 VRT514 28 1148580469 VRT515 31 1179235723 VRT516 34 1181209799 VRT517 33 1164142969 VRT518 35 1178105564 VRT519 34 1183350843 VRT52 3 1021932445 VRT520 80 1170807648 VRT521 36 1176484904 VRT522 41 1117019637 VRT523 44 1176620328 VRT524 36 1162782349 VRT525 56 1182497283 VRT526 29 1171905706 VRT527 32 1147917112 VRT528 33 1134345231 VRT529 9 1175701833 VRT53 490 1179856557 VRT530 15 1096944285 VRT531 10 1165202099 VRT532 14 1124145187 VRT533 29 1180765157 VRT534 35 1178361152 VRT535 32 1170937875 VRT536 32 1173142140 VRT537 35 1145113688 VRT538 33 1179097120 VRT539 21 660219629 VRT54 30 1161799788 VRT540 1 615875534 VRT541 2 1105114303 VRT542 2 866825881 VRT543 7 1071086852 VRT544 1 599604003 VRT545 2 1104265175 VRT546 2 871854003 VRT547 9 1173719138 VRT548 43 1170491298 VRT549 16 1117243963 VRT55 24 1180126066 VRT550 20 1165282722 VRT551 28 1174244875 VRT552 23 1177812695 VRT553 47 1156238227 VRT554 35 1164489122 VRT555 41 1159313923 VRT556 19 1180527231 VRT557 19 1152481298 VRT558 28 1119836045 VRT559 16 1176386525 VRT56 24 1139184549 VRT560 32 1152714310 VRT561 11 1112150843 VRT562 29 1181139876 VRT563 37 1174159316 VRT564 21 1171437407 VRT565 60 1160593066 VRT566 41 1161869314 VRT567 20 1176156563 VRT568 27 1163449936 VRT569 29 1177633590 VRT57 40 1180636041 VRT570 30 1151901863 VRT571 36 1076518354 VRT572 8 1154589000 VRT573 20 1177550621 VRT574 23 1171653770 VRT575 39 1184008602 VRT576 27 1156890170 VRT577 27 1183408135 VRT578 34 1103505028 VRT579 182202 737316169 VRT58 72 1164816936 VRT580 16847 22229429 VRT59 7 1156606571 VRT6 442 1174590449 VRT60 3 1012738546 VRT61 6 1130561284 VRT62 468 1183012903 VRT63 10 1163204068 VRT64 618 1178963146 VRT65 13 971142702 VRT66 5 1115794738 VRT67 6 1049980901 VRT68 34 1152243713 VRT69 20 1141871979 VRT7 150373 823778590 VRT70 38 1132348904 VRT71 226 1180434283 VRT72 21 1114739427 VRT73 21 1172326162 VRT74 51 1178107457 VRT75 20 1155655884 VRT76 18 1178031073 VRT77 23 1163970907 VRT78 23 1173390043 VRT79 23 1144234985 VRT8 27341 1114897079 VRT80 121 1171577138 VRT81 88 1150707413 VRT82 13 341388818 VRT83 1 843366180 VRT84 1 842558404 VRT85 1 707956555 VRT86 1 635713434 VRT87 2 1006930617 VRT88 6 953838719 VRT89 1 690654357 VRT9 39 1179792818 VRT90 2 1036857559 VRT91 3 1135937014 VRT92 37 1176417013 VRT93 23 1061257991 VRT94 4338 1142999379 VRT95 332223 561817428 VRT96 392224 420074243 VRT97 190406 779142184 VRT98 78 1166754041 VRT99 45 1182288817 2.2.7 Selected Per-Organism Statistics The following table provides the number of entries and bases of DNA/RNA for the twenty most sequenced organisms in Release 271.0, excluding chloroplast and mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences, 'constructed' CON-division sequences, synthetic construct sequences, uncultured sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study sequences: Entries Bases Species 1948752 405961950617 Triticum aestivum 9204178 273571729605 Severe acute respiratory syndrome coronavirus 2 30555 273192060156 Avena sativa 113643 259319130177 Hordeum vulgare 753 212675690135 Hordeum bulbosum 1347104 125991654054 Hordeum vulgare subsp. vulgare 164 93011095388 Viscum album 29978 92980378923 Hordeum vulgare subsp. spontaneum 10118677 46333339697 Mus musculus 28773499 38432937493 Homo sapiens 195553 37711874840 Escherichia coli 4711 37408102376 Solanum melongena 2643074 33455227111 Arabidopsis thaliana 2246081 33006519943 Bos taurus 43595 26206281917 Klebsiella pneumoniae 4224726 24918520894 Zea mays 28783 23037489636 Vicia faba 507 22852582653 Lissotriton helveticus 1634 22052877731 Triturus cristatus 248 21843250305 Avena sterilis 2.2.8 Growth of GenBank The following table lists the number of bases and the number of sequence records in each release of GenBank, beginning with Release 3 in 1982. CON-division records are not represented in these statistics: because they are constructed from the non-CON records in the database, their inclusion here would be a form of double-counting. Also note that this table is limited to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records. From 1982 to the present, the number of bases in GenBank has doubled approximately every 18 months. Release Date Base Pairs Entries 3 Dec 1982 680338 606 14 Nov 1983 2274029 2427 20 May 1984 3002088 3665 24 Sep 1984 3323270 4135 25 Oct 1984 3368765 4175 26 Nov 1984 3689752 4393 32 May 1985 4211931 4954 36 Sep 1985 5204420 5700 40 Feb 1986 5925429 6642 42 May 1986 6765476 7416 44 Aug 1986 8442357 8823 46 Nov 1986 9615371 9978 48 Feb 1987 10961380 10913 50 May 1987 13048473 12534 52 Aug 1987 14855145 14020 53 Sep 1987 15514776 14584 54 Dec 1987 16752872 15465 55 Mar 1988 19156002 17047 56 Jun 1988 20795279 18226 57 Sep 1988 22019698 19044 57.1 Oct 1988 23800000 20579 58 Dec 1988 24690876 21248 59 Mar 1989 26382491 22479 60 Jun 1989 31808784 26317 61 Sep 1989 34762585 28791 62 Dec 1989 37183950 31229 63 Mar 1990 40127752 33377 64 Jun 1990 42495893 35100 65 Sep 1990 49179285 39533 66 Dec 1990 51306092 41057 67 Mar 1991 55169276 43903 68 Jun 1991 65868799 51418 69 Sep 1991 71947426 55627 70 Dec 1991 77337678 58952 71 Mar 1992 83894652 65100 72 Jun 1992 92160761 71280 73 Sep 1992 101008486 78608 74 Dec 1992 120242234 97084 75 Feb 1993 126212259 106684 76 Apr 1993 129968355 111911 77 Jun 1993 138904393 120134 78 Aug 1993 147215633 131328 79 Oct 1993 157152442 143492 80 Dec 1993 163802597 150744 81 Feb 1994 173261500 162946 82 Apr 1994 180589455 169896 83 Jun 1994 191393939 182753 84 Aug 1994 201815802 196703 85 Oct 1994 217102462 215273 86 Dec 1994 230485928 237775 87 Feb 1995 248499214 269478 88 Apr 1995 286094556 352414 89 Jun 1995 318624568 425211 90 Aug 1995 353713490 492483 91 Oct 1995 384939485 555694 92 Dec 1995 425860958 620765 93 Feb 1996 463758833 685693 94 Apr 1996 499127741 744295 95 Jun 1996 551750920 835487 96 Aug 1996 602072354 920588 97 Oct 1996 651972984 1021211 98 Dec 1996 730552938 1114581 99 Feb 1997 786898138 1192505 100 Apr 1997 842864309 1274747 101 Jun 1997 966993087 1491069 102 Aug 1997 1053474516 1610848 103 Oct 1997 1160300687 1765847 104 Dec 1997 1258290513 1891953 105 Feb 1998 1372368913 2042325 106 Apr 1998 1502542306 2209232 107 Jun 1998 1622041465 2355928 108 Aug 1998 1797137713 2532359 109 Oct 1998 2008761784 2837897 110 Dec 1998 2162067871 3043729 111 Apr 1999 2569578208 3525418 112 Jun 1999 2974791993 4028171 113 Aug 1999 3400237391 4610118 114 Oct 1999 3841163011 4864570 115 Dec 1999 4653932745 5354511 116 Feb 2000 5805414935 5691170 117 Apr 2000 7376080723 6215002 118 Jun 2000 8604221980 7077491 119 Aug 2000 9545724824 8214339 120 Oct 2000 10335692655 9102634 121 Dec 2000 11101066288 10106023 122 Feb 2001 11720120326 10896781 123 Apr 2001 12418544023 11545572 124 Jun 2001 12973707065 12243766 125 Aug 2001 13543364296 12813516 126 Oct 2001 14396883064 13602262 127 Dec 2001 15849921438 14976310 128 Feb 2002 17089143893 15465325 129 Apr 2002 19072679701 16769983 130 Jun 2002 20648748345 17471130 131 Aug 2002 22616937182 18197119 132 Oct 2002 26525934656 19808101 133 Dec 2002 28507990166 22318883 134 Feb 2003 29358082791 23035823 135 Apr 2003 31099264455 24027936 136 Jun 2003 32528249295 25592865 137 Aug 2003 33865022251 27213748 138 Oct 2003 35599621471 29819397 139 Dec 2003 36553368485 30968418 140 Feb 2004 37893844733 32549400 141 Apr 2004 38989342565 33676218 142 Jun 2004 40325321348 35532003 143 Aug 2004 41808045653 37343937 144 Oct 2004 43194602655 38941263 145 Dec 2004 44575745176 40604319 146 Feb 2005 46849831226 42734478 147 Apr 2005 48235738567 44202133 148 Jun 2005 49398852122 45236251 149 Aug 2005 51674486881 46947388 150 Oct 2005 53655236500 49152445 151 Dec 2005 56037734462 52016762 152 Feb 2006 59750386305 54584635 153 Apr 2006 61582143971 56620500 154 Jun 2006 63412609711 58890345 155 Aug 2006 65369091950 61132599 156 Oct 2006 66925938907 62765195 157 Dec 2006 69019290705 64893747 158 Feb 2007 71292211453 67218344 159 Apr 2007 75742041056 71802595 160 Jun 2007 77248690945 73078143 161 Aug 2007 79525559650 76146236 162 Oct 2007 81563399765 77632813 163 Dec 2007 83874179730 80388382 164 Feb 2008 85759586764 82853685 165 Apr 2008 89172350468 85500730 166 Jun 2008 92008611867 88554578 167 Aug 2008 95033791652 92748599 168 Oct 2008 97381682336 96400790 169 Dec 2008 99116431942 98868465 170 Feb 2009 101467270308 101815678 171 Apr 2009 102980268709 103335421 172 Jun 2009 105277306080 106073709 173 Aug 2009 106533156756 108431692 174 Oct 2009 108560236506 110946879 175 Dec 2009 110118557163 112910950 176 Feb 2010 112326229652 116461672 177 Apr 2010 114348888771 119112251 178 Jun 2010 115624497715 120604423 179 Aug 2010 117476523128 122941883 180 Oct 2010 118551641086 125764384 181 Dec 2010 122082812719 129902276 182 Feb 2011 124277818310 132015054 183 Apr 2011 126551501141 135440924 184 Jun 2011 129178292958 140482268 185 Aug 2011 130671233801 142284608 186 Oct 2011 132067413372 144458648 187 Dec 2011 135117731375 146413798 188 Feb 2012 137384889783 149819246 189 Apr 2012 139266481398 151824421 190 Jun 2012 141343240755 154130210 191 Aug 2012 143081765233 156424033 192 Oct 2012 145430961262 157889737 193 Dec 2012 148390863904 161140325 194 Feb 2013 150141354858 162886727 195 Apr 2013 151178979155 164136731 196 Jun 2013 152599230112 165740164 197 Aug 2013 154192921011 167295840 198 Oct 2013 155176494699 168335396 199 Dec 2013 156230531562 169331407 200 Feb 2014 157943793171 171123749 201 Apr 2014 159813411760 171744486 202 Jun 2014 161822845643 173353076 203 Aug 2014 165722980375 174108750 204 Oct 2014 181563676918 178322253 205 Dec 2014 184938063614 179295769 206 Feb 2015 187893826750 181336445 207 Apr 2015 189739230107 182188746 208 Jun 2015 193921042946 185019352 209 Aug 2015 199823644287 187066846 210 Oct 2015 202237081559 188372017 211 Dec 2015 203939111071 189232925 212 Feb 2016 207018196067 190250235 213 Apr 2016 211423912047 193739511 214 Jun 2016 213200907819 194463572 215 Aug 2016 217971437647 196120831 216 Oct 2016 220731315250 197390691 217 Dec 2016 224973060433 198565475 218 Feb 2017 228719437638 199341377 219 Apr 2017 231824951552 200877884 220 Jun 2017 234997362623 201663568 221 Aug 2017 240343378258 203180606 222 Oct 2017 244914705468 203953682 223 Dec 2017 249722163594 206293625 224 Feb 2018 253630708098 207040555 225 Apr 2018 260189141631 208452303 226 Jun 2018 263957884539 209775348 227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease) 228 Oct 2018 279668290132 209656636 229 Dec 2018 285688542186 211281415 230 Feb 2019 303709510632 212260377 231 Apr 2019 321680566570 212775414 232 Jun 2019 329835282370 213383758 233 Aug 2019 366733917629 213865349 234 Oct 2019 386197018538 216763706 235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease) 236 Feb 2020 399376854872 216214215 237 Apr 2020 415770027949 216531829 238 Jun 2020 427823258901 217122233 239 Aug 2020 654057069549 218642238 240 Oct 2020 698688094046 219055207 241 Dec 2020 723003822007 221467827 242 Feb 2021 776291211106 226241476 243 Apr 2021 832400799511 227123201 244 Jun 2021 866009790959 227888889 245 Aug 2021 940513260726 231982592 246 Oct 2021 1014763752113 233642893 247 Dec 2021 1053275115030 234557297 248 Feb 2022 1173984081721 236338284 249 Apr 2022 1266154890918 237520318 250 Jun 2022 1395628631187 239017893 251 Aug 2022 1492800704497 239915786 252 Oct 2022 1562963366851 240539282 253 Dec 2022 1635594138493 241015745 254 Feb 2023 1731302248418 241830635 255 Apr 2023 1826746318813 242554936 256 Jun 2023 1966479976146 243560863 257 Aug 2023 2112058517945 246119175 258 Oct 2023 2433391164875 247777761 259 Dec 2023 2570711588044 249060436 n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024 260 Apr 2024 3213818003787 250803006 261 Jun 2024 3387240663231 251094334 262 Aug 2024 3675462701077 251998350 263 Oct 2024 4250942573681 252347664 264 Dec 2024 5085904976338 254365075 265 Feb 2025 5415448651743 255669865 266 Apr 2025 5794509308815 257038531 267 Jun 2025 5234752089196 258002002 (Section 1.3.1 of GB 267.0 release notes explains decrease) 268 Aug 2025 5676067778413 258320620 269 Dec 2025 6651459875408 259677058 270 Feb 2026 7010340901567 260943419 271 Apr 2026 7289942983522 261460182 The following table lists the number of bases and the number of sequence records for WGS sequences processed at GenBank, beginning with Release 129.0 in April of 2002. Please note that WGS data are not distributed in conjunction with GenBank releases. Rather, per-project data files are continuously available in the WGS areas of the NCBI FTP site: https://ftp.ncbi.nih.gov/ncbi-asn1/wgs https://ftp.ncbi.nih.gov/genbank/wgs Release Date Base Pairs Entries 129 Apr 2002 692266338 172768 130 Jun 2002 3267608441 397502 131 Aug 2002 3848375582 427771 132 Oct 2002 3892435593 434224 133 Dec 2002 6702372564 597042 134 Feb 2003 6705740844 597345 135 Apr 2003 6897080355 596818 136 Jun 2003 6992663962 607155 137 Aug 2003 7144761762 593801 138 Oct 2003 8662242833 1683437 139 Dec 2003 14523454868 2547094 140 Feb 2004 22804145885 3188754 141 Apr 2004 24758556215 4112532 142 Jun 2004 25592758366 4353890 143 Aug 2004 28128611847 4427773 144 Oct 2004 30871590379 5285276 145 Dec 2004 35009256228 5410415 146 Feb 2005 38076300084 6111782 147 Apr 2005 39523208346 6685746 148 Jun 2005 46767232565 8711924 149 Aug 2005 53346605784 10276161 150 Oct 2005 56162807647 11169448 151 Dec 2005 59638900034 12088491 152 Feb 2006 63183065091 12465546 153 Apr 2006 67488612571 13573144 154 Jun 2006 78858635822 17733973 155 Aug 2006 80369977826 17960667 156 Oct 2006 81127502509 18500772 157 Dec 2006 81611376856 18540918 158 Feb 2007 86043478524 19421576 159 Apr 2007 93022691867 23446831 160 Jun 2007 97102606459 23718400 161 Aug 2007 101964323738 25384475 162 Oct 2007 102003045298 25354041 163 Dec 2007 106505691578 26177471 164 Feb 2008 108635736141 27439206 165 Apr 2008 110500961400 26931049 166 Jun 2008 113639291344 39163548 167 Aug 2008 118593509342 40214247 168 Oct 2008 136085973423 46108952 169 Dec 2008 141374971004 48394838 170 Feb 2009 143797800446 49036947 171 Apr 2009 144522542010 48948309 172 Jun 2009 145959997864 49063546 173 Aug 2009 148165117763 48443067 174 Oct 2009 149348923035 48119301 175 Dec 2009 158317168385 54076973 176 Feb 2010 163991858015 57134273 177 Apr 2010 165536009514 58361599 178 Jun 2010 167725292032 58592700 179 Aug 2010 169253846128 58994334 180 Oct 2010 175339059129 59397637 181 Dec 2010 177385297156 59608311 182 Feb 2011 190034462797 62349795 183 Apr 2011 191401393188 62715288 184 Jun 2011 200487078184 63735078 185 Aug 2011 208315831132 64997137 186 Oct 2011 218666368056 68330215 187 Dec 2011 239868309609 73729553 188 Feb 2012 261370512675 78656704 189 Apr 2012 272693351548 80905298 190 Jun 2012 287577367116 82076779 191 Aug 2012 308196411905 84020064 192 Oct 2012 333881846451 86480509 193 Dec 2012 356002922838 92767765 194 Feb 2013 390900990416 103101291 195 Apr 2013 418026593606 110509314 196 Jun 2013 453829752320 112488036 197 Aug 2013 500420412665 124812020 198 Oct 2013 535842167741 130203205 199 Dec 2013 556764321498 133818570 200 Feb 2014 591378698544 139725795 201 Apr 2014 621015432437 143446790 202 Jun 2014 719581958743 175779064 203 Aug 2014 774052098731 189080419 204 Oct 2014 805549167708 196049974 205 Dec 2014 848977922022 200301550 206 Feb 2015 873281414087 205465046 207 Apr 2015 969102906813 243779199 208 Jun 2015 1038937210221 258702138 209 Aug 2015 1163275601001 302955543 210 Oct 2015 1222635267498 309198943 211 Dec 2015 1297865618365 317122157 212 Feb 2016 1399865495608 333012760 213 Apr 2016 1452207704949 338922537 214 Jun 2016 1556175944648 350278081 215 Aug 2016 1637224970324 359796497 216 Oct 2016 1676238489250 363213315 217 Dec 2016 1817189565845 395301176 218 Feb 2017 1892966308635 409490397 219 Apr 2017 2035032639807 451840147 220 Jun 2017 2164683993369 487891767 221 Aug 2017 2242294609510 499965722 222 Oct 2017 2318156361999 508825331 223 Dec 2017 2466098053327 551063065 224 Feb 2018 2608532210351 564286852 225 Apr 2018 2784740996536 621379029 226 Jun 2018 2944617324086 639804105 227 Aug 2018 3204855013281 665309765 228 Oct 2018 3444172142207 722438528 229 Dec 2018 3656719423096 773773190 230 Feb 2019 4164513961679 945019312 231 Apr 2019 4421986382065 993732214 232 Jun 2019 4847677297950 1022913321 233 Aug 2019 5585922333160 1075272215 234 Oct 2019 5985250251028 1097629174 235 Dec 2019 6277551200690 1127023870 236 Feb 2020 6968991265752 1206720688 237 Apr 2020 7788133221338 1267547429 238 Jun 2020 8114046262158 1302852615 239 Aug 2020 8841649410652 1408122887 240 Oct 2020 9215815569509 1432874252 241 Dec 2020 11830842428018 1517995689 242 Feb 2021 12270717209612 1563938043 243 Apr 2021 12732048052023 1590670459 244 Jun 2021 13442974346437 1632796606 245 Aug 2021 13888187863722 1653427055 246 Oct 2021 14599101574547 1721064101 247 Dec 2021 14922033922302 1734664952 248 Feb 2022 15428122140820 1750505007 249 Apr 2022 16071520702170 1781374217 250 Jun 2022 16710373006600 1796349114 251 Aug 2022 17511809676629 2024099677 252 Oct 2022 18231960808828 2167900306 253 Dec 2022 19086596616569 2241439349 254 Feb 2023 20116642176263 2337838461 255 Apr 2023 20926504760221 2440470464 256 Jun 2023 21791125594114 2611654455 257 Aug 2023 22294446104543 2631493489 258 Oct 2023 23600199887231 2775205599 259 Dec 2023 24651580464335 2863228552 n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024 260 Apr 2024 27225116587937 3333621823 261 Jun 2024 27900199328333 3380877515 262 Aug 2024 29643594176326 3569715357 263 Oct 2024 31362454467668 3745772758 264 Dec 2024 32983029087303 3957195833 265 Feb 2025 35643977584264 4152691448 266 Apr 2025 37294058110495 4234652334 267 Jun 2025 38384788365670 4294972923 268 Aug 2025 40390433406298 4441331387 269 Dec 2025 42125323988215 4540323299 270 Feb 2026 43580847616334 4620211924 271 Apr 2026 45628511953497 4756526485 The following table provides the number of bases and the number of sequence records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing projects processed at GenBank, beginning with Release 190.0 in June of 2012. TSA sequences processed prior to Release 190.0 in June of 2012 were handled individually, and are present in the gbtsa*.seq files of GenBank releases (hence, they contribute to the statistics in the first table of this section). Subsequent to that date NCBI began processing TSA submissions using an approach that is analogous to the bulk-oriented approach used for WGS, assigning a TSA project code (for example: GAAA) to each TSA submission. Note 1 : Although we provide statistics for bulk-oriented TSA submissions as of the dates for GenBank releases, TSA files are not distributed or updated in conjunction with those releases. Rather, per-project TSA data files are continuously available in the TSA areas of the NCBI FTP site: https://ftp.ncbi.nih.gov/ncbi-asn1/tsa https://ftp.ncbi.nih.gov/genbank/tsa Note 2 : NCBI's partner institutions within the INSDC might still choose to treat TSA submissions as separate records, without a common TSA project code. In which case, they will not be included in this table. Note 3 : Statistics for bulk-oriented TSA projects originating at the European Nucleotide Archive of the INSDC were not included in this table until the October 2016 GenBank Release. Note 4 : This table is incomplete. Statistics for Releases 190.0 to 200.0 will be back-filled if time allows. Release Date Base Pairs Entries 201 Apr 2014 23632325832 29734989 202 Jun 2014 31707343431 38011942 203 Aug 2014 33676182560 40556905 204 Oct 2014 36279458440 43567759 205 Dec 2014 46056420903 62635617 206 Feb 2015 49765340047 66706014 207 Apr 2015 55796332435 71989588 208 Jun 2015 60697472570 76974601 209 Aug 2015 69360654413 87827013 210 Oct 2015 70917172944 81790031 211 Dec 2015 77583339176 87488539 212 Feb 2016 81932555094 92132318 213 Apr 2016 87811163676 98147566 214 Jun 2016 94413958919 104677061 215 Aug 2016 103399742586 113179607 216 Oct 2016 113209225762 124199597 217 Dec 2016 125328824508 142094337 218 Feb 2017 133517212104 151431485 219 Apr 2017 149038907599 165068542 220 Jun 2017 158112969073 176812130 221 Aug 2017 167045663417 186777106 222 Oct 2017 172909268535 192754804 223 Dec 2017 181394660188 201559502 224 Feb 2018 193940551226 214324264 225 Apr 2018 205232396043 227364990 226 Jun 2018 216556686631 238788334 227 Aug 2018 225520004678 249295386 228 Oct 2018 235875573598 259927414 229 Dec 2018 248592892188 274845473 230 Feb 2019 263936885705 294772430 231 Apr 2019 277118019688 311247136 232 Jun 2019 285390240861 319927264 233 Aug 2019 294727165179 331347807 234 Oct 2019 305371891408 342811151 235 Dec 2019 325433016129 367193844 236 Feb 2020 340994289065 386644871 237 Apr 2020 349692751528 396392280 238 Jun 2020 359947709062 409725050 239 Aug 2020 366968951160 417524567 240 Oct 2020 382996662270 435968379 241 Dec 2020 392206975386 446397378 242 Feb 2021 407605409948 463151000 243 Apr 2021 425076483459 481154920 244 Jun 2021 436594941165 494641358 245 Aug 2021 440578422611 498305045 246 Oct 2021 449891016597 508319391 247 Dec 2021 455870853358 514158576 248 Feb 2022 465013156502 524464601 249 Apr 2022 474421076448 534770586 250 Jun 2022 485056129761 546991572 251 Aug 2022 497501380386 560196830 252 Oct 2022 511476787957 574020080 253 Dec 2022 611850391049 649918843 254 Feb 2023 630615054587 672261981 255 Apr 2023 636291358227 678332682 256 Jun 2023 643127590034 683922756 257 Aug 2023 646176166908 686271945 258 Oct 2023 659924904311 701336089 259 Dec 2023 668807109326 715803123 n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024 260 Apr 2024 689648317082 741066498 261 Jun 2024 695405769319 746753803 262 Aug 2024 706085554263 755907377 263 Oct 2024 812661461811 948733596 264 Dec 2024 820128973511 957403887 265 Feb 2025 824439978941 961491801 266 Apr 2025 852869986922 996759705 267 Jun 2025 859712036434 1006416037 268 Aug 2025 864483775194 1010159820 269 Dec 2025 878730431459 1033885396 270 Feb 2026 889101948297 1046996602 271 Apr 2026 898651493967 1058643373 The following table provides the number of bases and the number of sequence records for Targeted Locus Study (TLS) sequencing projects of special marker genes processed at GenBank, beginning with Release 217.0 in December of 2016. Note 1 : Although we provide statistics for bulk-oriented TLS submissions as of the dates for GenBank releases, TLS files are not distributed or updated in conjunction with those releases. Rather, per-project TLS data files are continuously available in the TLS areas of the NCBI FTP site: https://ftp.ncbi.nih.gov/ncbi-asn1/tls https://ftp.ncbi.nih.gov/genbank/tls Note 2 : NCBI's partner institutions within the INSDC might still choose to treat TLS submissions as separate records, without a common TLS project code. In which case, they will not be included in this table. Note 3 : This table is incomplete. Statistics for releases prior to 217.0 will be back-filled if time allows. Release Date Base Pairs Entries 217 Dec 2016 584697919 1268690 218 Feb 2017 636923295 1438349 219 Apr 2017 636923295 1438349 (unchanged) 220 Jun 2017 824191338 1628475 221 Aug 2017 824191338 1628475 (unchanged) 222 Oct 2017 2993818315 9479460 223 Dec 2017 4458042616 12695198 224 Feb 2018 4531966831 12819978 225 Apr 2018 5612769448 14782654 226 Jun 2018 5896511468 15393041 227 Aug 2018 6077824493 15822538 228 Oct 2018 8435112913 20752288 229 Dec 2018 8511829281 20924588 230 Feb 2019 9146836085 23259929 231 Apr 2019 9623321565 24240761 232 Jun 2019 10182427815 25530139 233 Aug 2019 10531800829 26363945 234 Oct 2019 10848455369 27460978 235 Dec 2019 11280596614 28227180 236 Feb 2020 13669678196 34037371 237 Apr 2020 24615270313 65521132 238 Jun 2020 27500635128 75063181 239 Aug 2020 27825059498 75682157 240 Oct 2020 28814798868 78177358 241 Dec 2020 33036509446 88039152 242 Feb 2021 33634122995 90130561 243 Apr 2021 37998534461 102395753 244 Jun 2021 38198113354 102662929 245 Aug 2021 39930167315 106995218 246 Oct 2021 40168874815 107569935 247 Dec 2021 41143480750 109379021 248 Feb 2022 41321107981 109809966 249 Apr 2022 41324192343 109820387 250 Jun 2022 41999358847 111142107 251 Aug 2022 43852280645 115103527 252 Oct 2022 43860512749 115123306 253 Dec 2022 44009657455 115552377 254 Feb 2023 46465508548 121067644 255 Apr 2023 46567924833 121186672 256 Jun 2023 47302831210 122798571 257 Aug 2023 48289699026 124421006 258 Oct 2023 50868407906 130654568 259 Dec 2023 51568356978 132355132 n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024 260 Apr 2024 53492243256 135115766 261 Jun 2024 54512778803 135446337 262 Aug 2024 77026446552 187321998 Spike caused by restoration of stats for the Aug 2021 KEQH TLS project : 48-mln records 263 Oct 2024 77037504468 187349395 264 Dec 2024 77038271475 187349466 265 Feb 2025 78062322564 189703939 266 Apr 2025 78390585331 190122348 267 Jun 2025 78505522921 190342492 268 Aug 2025 78568415110 190505830 269 Dec 2025 78916795339 190904203 270 Feb 2026 79162820303 191365090 271 Apr 2026 79162820303 191365090 (unchanged) 3. FILE FORMATS The flat file examples included in this section, while not always from the current release, are usually fairly recent. Any differences compared to the actual records are the result of updates to the entries involved. 3.1 File Header Information With the exception of the lists of new, changed, and deleted accession numbers, each of the files of a GenBank release begins with the same header, except for the first line, which contains the file name, and the sixth line, which contains the title of the file. The first line of the file contains the file name in character positions 1 to 9 and the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting in column 22. The brief names of the files in this release are listed in Section 2.2. The second line contains the date of the current release in the form `month day year', beginning in position 27. The fourth line contains the current GenBank release number. The release number appears in positions 48 to 52 and consists of three numbers separated by a decimal point. The number to the left of the decimal is the major release number. The digit to the right of the decimal indicates the version of the major release; it is zero for the first version. The sixth line contains a title for the file. The eighth line lists the number of entries (loci), number of bases (or base pairs), and number of reports of sequences (equal to number of entries in this case). These numbers are right-justified at fixed positions. The number of entries appears in positions 1 to 8, the number of bases in positions 16 to 26, and the number of reports in positions 40 to 47. The third, fifth, seventh, and ninth lines are blank. 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- GBBCT1.SEQ Genetic Sequence Data Bank April 15 2026 NCBI-GenBank Flat File Release 271.0 Bacterial Sequences (Part 1) 179375 loci, 605524051 bases, from 179375 reported sequences ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 1. Sample File Header 3.4 Sequence Entry Files GenBank releases contain one or more sequence entry data files, one for each "division" of GenBank. 3.4.1 File Organization Each of these files has the same format and consists of two parts: header information (described in section 3.1) and sequence entries for that division (described in the following sections). 3.4.2 Entry Organization In the second portion of a sequence entry file (containing the sequence entries for that division), each record (line) consists of two parts. The first part is found in positions 1 to 10 and may contain: 1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is a keyword). 2. A subkeyword beginning in column 3, with columns 1 and 2 blank (e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a subkeyword of REFERENCE). 3. Blank characters, indicating that this record is a continuation of the information under the keyword or subkeyword above it. 4. A code, beginning in column 6, indicating the nature of an entry (feature key) in the FEATURES table; these codes are described in Section 3.4.12.1 below. 5. A number, ending in column 9 of the record. This number occurs in the portion of the entry describing the actual nucleotide sequence and designates the numbering of sequence positions. 6. Two slashes (//) in positions 1 and 2, marking the end of an entry. The second part of each sequence entry record contains the information appropriate to its keyword, in positions 13 to 80 for keywords and positions 11 to 80 for the sequence. The following is a brief description of each entry field. Detailed information about each field may be found in Sections 3.4.4 to 3.4.15. LOCUS - A short mnemonic name for the entry, chosen to suggest the sequence's definition. Mandatory keyword/exactly one record. DEFINITION - A concise description of the sequence. Mandatory keyword/one or more records. ACCESSION - The primary accession number is a unique, unchanging identifier assigned to each GenBank sequence record. (Please use this identifier when citing information from GenBank.) Mandatory keyword/one or more records. VERSION - A compound identifier consisting of the primary accession number and a numeric version number associated with the current version of the sequence data in the record. This is optionally followed by an integer identifier (a "GI") assigned to the sequence by NCBI. Mandatory keyword/exactly one record. NOTE : Presentation of GI sequence identifiers in the GenBank flatfile format was discontinued as of March 2017. NID - An alternative method of presenting the NCBI GI identifier (described above). NOTE: The NID linetype is obsolete and was removed from the GenBank flatfile format in December 1999. PROJECT - The identifier of a project (such as a Genome Sequencing Project) to which a GenBank sequence record belongs. Optional keyword/one or more records. NOTE: The PROJECT linetype is obsolete and was removed from the GenBank flatfile format after Release 171.0 in April 2009. DBLINK - Provides cross-references to resources that support the existence a sequence record, such as the Project Database and the NCBI Trace Assembly Archive. Optional keyword/one or more records. KEYWORDS - Short phrases describing gene products and other information about an entry. Mandatory keyword in all annotated entries/one or more records. SEGMENT - Information on the order in which this entry appears in a series of discontinuous sequences from the same molecule. Optional keyword (only in segmented entries)/exactly one record. NOTE: The SEGMENT linetype is obsolete given the conversion of of all segmented sets to gapped CON-division records, completed as of GenBank Release 221.0 in August 2017. No new segmented set submissions will be accepted by GenBank. SOURCE - Common name of the organism or the name most frequently used in the literature. Mandatory keyword in all annotated entries/one or more records/includes one subkeyword. ORGANISM - Formal scientific name of the organism (first line) and taxonomic classification levels (second and subsequent lines). Mandatory subkeyword in all annotated entries/two or more records. In the event that the organism name exceeds 68 characters (80 - 13 + 1) in length, it will be line-wrapped and continue on a second line, prior to the taxonomic classification. Unfortunately, very long organism names were not anticipated when the fixed-length GenBank flatfile format was defined in the 1980s. The possibility of linewraps makes the job of flatfile parsers more difficult : essentially, one cannot be sure that the second line is truly a classification/lineage unless it consists of multiple tokens, delimited by semi-colons. The long-term solution to this problem is to introduce an additional subkeyword, possibly 'LINEAGE'. But because changes like this can be very disruptive for customers, implementation has not yet been scheduled. REFERENCE - Citations for all articles containing data reported in this entry. Includes seven subkeywords and may repeat. Mandatory keyword/one or more records. AUTHORS - Lists the authors of the citation. Optional subkeyword/one or more records. CONSRTM - Lists the collective names of consortiums associated with the citation (eg, International Human Genome Sequencing Consortium), rather than individual author names. Optional subkeyword/one or more records. TITLE - Full title of citation. Optional subkeyword (present in all but unpublished citations)/one or more records. JOURNAL - Lists the journal name, volume, year, and page numbers of the citation. Mandatory subkeyword/one or more records. MEDLINE - Provides the Medline unique identifier for a citation. Optional subkeyword/one record. NOTE: The MEDLINE linetype is obsolete and was removed from the GenBank flatfile format in April 2005. PUBMED - Provides the PubMed unique identifier for a citation. Optional subkeyword/one record. REMARK - Specifies the relevance of a citation to an entry. Optional subkeyword/one or more records. COMMENT - Cross-references to other sequence entries, comparisons to other collections, notes of changes in LOCUS names, and other remarks. Optional keyword/one or more records/may include blank records. FEATURES - Table containing information on portions of the sequence that code for proteins and RNA molecules and information on experimentally determined sites of biological significance. Optional keyword/one or more records. BASE COUNT - Summary of the number of occurrences of each basepair code (a, c, t, g, and other) in the sequence. Optional keyword/exactly one record. NOTE: The BASE COUNT linetype is obsolete and was removed from the GenBank flatfile format in October 2003. CONTIG - This linetype provides information about how individual sequence records can be combined to form larger-scale biological objects, such as chromosomes or complete genomes. Rather than presenting actual sequence data, a special join() statement on the CONTIG line provides the accession numbers and basepair ranges of the underlying records which comprise the object. As of August 2005, the 2L chromosome arm of Drosophila melanogaster (accession number AE014134) provided a good example of CONTIG use. ORIGIN - Specification of how the first base of the reported sequence is operationally located within the genome. Where possible, this includes its location within a larger genetic map. Mandatory keyword/exactly one record. - The ORIGIN line is followed by sequence data (multiple records). // - Entry termination symbol. Mandatory at the end of an entry/exactly one record. 3.4.3 Sample Sequence Data File An example of a complete sequence entry file follows. (This example has only two entries.) Note that in this example, as throughout the data bank, numbers in square brackets indicate items in the REFERENCE list. For example, in ACARR58S, [1] refers to the paper by Mackay, et al. 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- GBSMP.SEQ Genetic Sequence Data Bank December 15 1992 GenBank Flat File Release 74.0 Structural RNA Sequences 2 loci, 236 bases, from 2 reported sequences LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986 DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA. ACCESSION K03160 VERSION K03160.1 KEYWORDS 5S ribosomal RNA; ribosomal RNA. SOURCE A.auricula-judae (mushroom) ribosomal RNA. ORGANISM Auricularia auricula-judae Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes; Heterobasidiomycetidae; Auriculariales; Auriculariaceae. REFERENCE 1 (bases 1 to 118) AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R. TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and their use in studying the phylogenetic position of basidiomycetes among the eukaryotes JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983) FEATURES Location/Qualifiers rRNA 1..118 /note="5S ribosomal RNA" BASE COUNT 27 a 34 c 34 g 23 t ORIGIN 5' end of mature rRNA. 1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga 61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt // LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990 DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence. ACCESSION M34766 VERSION M34766.1 KEYWORDS 5S ribosomal RNA. SOURCE Acetobacter sp. (strain MB 58) rRNA. ORGANISM Acetobacter sp. Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci; Azotobacteraceae. REFERENCE 1 (bases 1 to 118) AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I., Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M. TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA sequencing JOURNAL J. Gen. Microbiol. 136, 441-446 (1990) FEATURES Location/Qualifiers rRNA 1..118 /note="5S ribosomal RNA" BASE COUNT 27 a 40 c 32 g 17 t 2 others ORIGIN 1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat 61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy // ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 9. Sample Sequence Data File 3.4.4 LOCUS Format 3.4.4.1 : Important notice about parsing the LOCUS line Users who process the data elements of the LOCUS line should use a token-based parsing approach rather than parsing its content based on fixed column positions. Historically, the LOCUS line has had a fixed length and its elements have been presented at specific column positions. A complete description of the data fields and their typical column positions is provided in Section 3.4.4.2 . But with the anticipated increases in the lengths of accession numbers, and the advent of sequences that are gigabases long, maintaining the column positions will not always be possible and the overall length of the LOCUS line could exceed 79 characters. Consider this LOCUS line for a typical complete bacterial genome: LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018 ------------+--------------+-+---------+---------+---------+---------+--------- 1 13 28 30 40 50 60 70 79 Now contrast this with a hypothetical gigabase-scale WGS sequence record that utilizes the 6 + 2 + 7/8/9 accession format: LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018 ------------+--------------+-+---------+---------+---------+---------+--------- 1 13 28 30 40 50 60 70 79 Here, Locus-Name/Accession-Number must occupy the space at position 29 which normally separates the Locus from the Sequence Length. And if the sequence length had been 10 Gigabases or greater, the Locus-Name and Sequence Length would directly abut each other: LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018 ------------+--------------+-+---------+---------+---------+---------+--------- 1 13 28 30 40 50 60 70 79 In cases like this, a space would be introduced to ensure that the two fields are separated, all other values would be shifted to the right, and the length of the LOCUS line would increase: LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018 ------------+--------------+-+---------+---------+---------+---------+--------- 1 13 28 30 40 50 60 70 79 Because the Locus-Name/Accession-Number is left-justified and the Sequence-Length is right-justified, *most* GenBank records will conform to the historical column positions that are described below. But since there will be exceptions, we recommend that users parse the LOCUS line based on whitespace-separated tokens. 3.4.4.2 : Data elements of the LOCUS line The data elements of the LOCUS line format and their typical/historical column positions are as follows: Positions Contents --------- -------- 01-05 'LOCUS' 06-12 spaces 13-28 Locus Name (usually identical to the Accession Number) 29-29 space 30-40 Sequence Length, right-justified 41-41 space 42-43 'bp' 44-44 space 45-47 Strandedness : spaces (if not known), ss- (single-stranded), ds- (double-stranded), or ms- (mixed-stranded) 48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), mRNA (messenger RNA), uRNA (small nuclear RNA), cRNA (viral cRNA) Left justified. 54-55 space 56-63 Molecule Topology : 'linear' followed by two spaces, or 'circular' 64-64 space 65-67 Division Code 68-68 space 69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991) These column positions are typical/nominal, not guaranteed. See Section 3.4.4.1 for important suggestions about parsing the LOCUS line. The Locus Name element was originally designed to help group entries with similar sequences: the first three characters designated the organism; the fourth and fifth characters could be used to show other group designations, such as gene product; for segmented entries (now obsolete) the last character could be one of a series of sequential integers. Here are two examples of older GenBank records that have Locus Names : LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993 DEFINITION Human D9S125 polymorphic dinucleotide repeat. ACCESSION L10620 LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993 DEFINITION Human D9S114 polymorphic dinucleotide repeat. ACCESSION L10624 But in the mid-1990s, maintaining unique Locus Names in addition to unique Accession Numbers became unsustainable and the assignment of new Locus Names ceased. The overwhelming majority of sequence records now have no Locus Name, and their Accession Number is displayed on the LOCUS line instead. For example: LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998 DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA, complete cds. ACCESSION AF035771 The Division Code element of the LOCUS format is a three-letter abbreviation whose value can be : PRI - primate sequences ROD - rodent sequences MAM - other mammalian sequences VRT - other vertebrate sequences INV - invertebrate sequences PLN - plant, fungal, and algal sequences BCT - bacterial sequences VRL - viral sequences PHG - bacteriophage sequences SYN - synthetic sequences UNA - unannotated sequences EST - EST sequences (Expressed Sequence Tags) PAT - patent sequences STS - STS sequences (Sequence Tagged Sites) GSS - GSS sequences (Genome Survey Sequences) HTG - HTGS sequences (High Throughput Genomic sequences) HTC - HTC sequences (High Throughput cDNA sequences) ENV - Environmental sampling sequences CON - Constructed sequences TSA - Transcriptome Shotgun Assembly sequences The Molecule Type for all non-coding RNA sequences is 'RNA'. Further information about the specific type of non-coding RNA can be obtained from the full-length ncRNA feature that will be present on such sequences. 3.4.5 DEFINITION Format The DEFINITION record gives a brief description of the sequence, proceeding from general to specific. It starts with the common name of the source organism, then gives the criteria by which this sequence is distinguished from the remainder of the source genome, such as the gene name and what it codes for, or the protein name and mRNA, or some description of the sequence's function (if the sequence is non-coding). If the sequence has a coding region, the description may be followed by a completeness qualifier, such as cds (complete coding sequence). There is no limit on the number of lines that may be part of the DEFINITION. The last line must end with a period. 3.4.5.1 DEFINITION Format for NLM Entries The DEFINITION line for entries derived from journal-scanning at the NLM is an automatically generated descriptive summary that accompanies each DNA and protein sequence. It contains information derived from fields in a database that summarize the most important attributes of the sequence. The DEFINITION lines are designed to supplement the accession number and the sequence itself as a means of uniquely and completely specifying DNA and protein sequences. The following are examples of NLM DEFINITION lines: NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt] 94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA Partial, 1 gene, 1873 nt] inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment 1 of 2] cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase [Acremonium chrysogenum, Genomic, 2 genes, 2639 nt] myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails, embryo, Peptide Partial, 246 aa] The first part of the definition line contains information describing the genes and proteins represented by the molecular sequences. This can be gene locus names, protein names and descriptions that replace or augment actual names. Gene and gene product are linked by "=". Any special identifying terms are presented within brackets, such as: {promoter}, {N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}. The second part of the definition line is delimited by square brackets, '[]', and provides details about the molecule type and length. The biological source, i.e., genus and species or common name as cited by the author. Developmental stage, tissue type and strain are included if available. The molecule types include: Genomic, mRNA, Peptide. and Other Genomic Material. Genomic molecules are assumed to be partial sequence unless "Complete" is specified, whereas mRNA and peptide molecules are assumed to be complete unless "Partial" is noted. 3.4.6 ACCESSION Format This field contains a series of six-character and/or eight-character identifiers called 'accession numbers'. The six-character accession number format consists of a single uppercase letter, followed by 5 digits. The eight-character accession number format consists of two uppercase letters, followed by 6 digits. The 'primary', or first, of the accession numbers occupies positions 13 to 18 (6-character format) or positions 13 to 20 (8-character format). Subsequent 'secondary' accession numbers (if present) are separated from the primary, and from each other, by a single space. In some cases, multiple lines of secondary accession numbers might be present, starting at position 13. The primary accession number of a GenBank entry provides a stable identifier for the biological object that the entry represents. Accessions do not change when the underlying sequence data or associated features change. Secondary accession numbers arise for a number of reasons. For example, a single accession number may initially be assigned to a sequence described in a publication. If it is later discovered that the sequence must be entered into the database as multiple entries, each entry would receive a new primary accession number, and the original accession number would appear as a secondary accession number on each of the new entries. In the event that a large number of continuous secondary accession numbers exist, a range can be employed: SecAccession1-SecAccession2 In such cases, the alphabetic prefix letters of the initial and terminal accession numbers within the range *MUST* be identical. For example: AE000111-AE000510O ^^ ^^ Additionally, the value of the numeric portion of the initial secondary within the range must be less than the value of the numeric portion of the terminal secondary. 3.4.7.1 VERSION Format This line contains a compound identifier consisting of the accession number plus the sequential version number of the associated sequence. LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999 DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds. ACCESSION AF181452 VERSION AF181452.1 ^^^^^^^^^^ Compound Accession.Version Number A compound Accession.Version consists of two parts: a stable, unchanging primary-accession number portion (see Section 3.4.6 for a description of accession numbers), and a sequentially increasing numeric version number. The accession and version numbers are separated by a period. The initial version number assigned to a new sequence is one. An accession number allows one to retrieve the same biological object in the database, regardless of any changes that are made to the entry over time. But those changes can include changes to the sequence data itself, which is of fundamental importance to many database users. So a numeric version number is associated with the sequence data in every database entry. If an entry (for example, AF181452) undergoes two sequence changes, its compound accession number on the VERSION line would start as AF181452.1 . After the first sequence change this would become: AF181452.2 . And after the second change: AF181452.3 . Numeric NCBI "GI" sequence identifiers also used to be included on the VERSION line, but that practice was discontinued in March of 2017. GenBank Releases contain only the most recent versions of all sequences in the database. However, older versions can be obtained via Accession.Version-based queries with NCBI's web-Entrez and network-Entrez applications. A sequence 'revision history' resource is also available, within Entrez:Nucleotide. For example: http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist NOTE: All the version numbers for the compound Accession.Version identifier system were initialized to a value of one (".1") in February 1999, when the system was first introduced. 3.4.7.2 DBLINK Format This line contains cross-references to other underlying resources that support the existence of a GenBank sequence record. For example: LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012 DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence. ACCESSION ANHA01000001 ANHA01000000 VERSION ANHA01000001.1 DBLINK BioProject: PRJNA177352 BioSample: SAMN01795900 A DBLINK cross-reference consists of two data fields delimited by a colon. The first field provides the cross-reference type ("BioProject"), while the second contains the actual cross-reference identifier ("PRJNA177352"). The second field can consist of multiple comma-separated identifiers, if a sequence record has multiple DBLINK cross-references of a given type. For example: DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999 And, as in this example, there can be multiple distinct types of DBLINK cross-references. Each new type will start on a new line, with the first colon-delimited token being the name of the cross-referenced resource. As of April 2013, the supported DBLINK cross-reference types are "Project" (predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive", "Sequence Read Archive", and "Assembly". DBLINK cross-references of type 'BioProject' are BioProject Accession Number identifiers within the Entrez:BioProject resource at the NCBI: http://www.ncbi.nlm.nih.gov/bioproject At the above URL, a search for PRJNA177352 would provide information about the Campylobacter coli sequencing project (underway or completed), the center(s) performing the sequencing and annotation, information about the organism, etc. For a more detailed overview of NCBI's BioProject resource: http://www.ncbi.nlm.nih.gov/books/NBK54016/ DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within the Assembly resource at NCBI: http://www.ncbi.nlm.nih.gov/assembly At the above URL, a search for GCA_000321225.1 would provide assembly details and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly submitted by the center(s) that performed the assembly. For a more detailed overview of NCBI's Assembly resource: http://www.ncbi.nlm.nih.gov/assembly/help/ 3.4.8 KEYWORDS Format The KEYWORDS field does not appear in unannotated entries, but is required in all annotated entries. Keywords are separated by semicolons; a "keyword" may be a single word or a phrase consisting of several words. Each line in the keywords field ends in a semicolon; the last line ends with a period. If no keywords are included in the entry, the KEYWORDS record contains only a period. 3.4.9 SEGMENT Format NOTE: The SEGMENT linetype is obsolete given the conversion of of all segmented sets to gapped CON-division records, completed as of GenBank Release 221.0 in August 2017. No new segmented set submissions will be accepted by GenBank. The SEGMENT keyword is used when two (or more) entries of known relative orientation are separated by a short (<10 kb) stretch of DNA. It is limited to one line of the form `n of m', where `n' is the segment number of the current entry and `m' is the total number of segments. 3.4.10 SOURCE Format The SOURCE field consists of two parts. The first part is found after the SOURCE keyword and contains free-format information including an abbreviated form of the organism name followed by a molecule type; multiple lines are allowed, but the last line must end with a period. The second part consists of information found after the ORGANISM subkeyword. The formal scientific name for the source organism (genus and species, where appropriate) is found on the same line as ORGANISM. The records following the ORGANISM line list the taxonomic classification levels, separated by semicolons and ending with a period. 3.4.11 REFERENCE Format The REFERENCE field consists of five parts: the keyword REFERENCE, and the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional), PUBMED (optional), and REMARK (optional). The REFERENCE line contains the number of the particular reference and (in parentheses) the range of bases in the sequence entry reported in this citation. Additional prose notes may also be found within the parentheses. The numbering of the references does not reflect publication dates or priorities. The AUTHORS line lists the authors in the order in which they appear in the cited article. Last names are separated from initials by a comma (no space); there is no comma before the final `and'. The list of authors ends with a period. The TITLE line is an optional field, although it appears in the majority of entries. It does not appear in unpublished sequence data entries that have been deposited directly into the GenBank data bank, the European Nucleotide Archive, or the DNA Data Bank of Japan. The TITLE field does not end with a period. The JOURNAL line gives the appropriate literature citation for the sequence in the entry. The word `Unpublished' will appear after the JOURNAL subkeyword if the data did not appear in the scientific literature, but was directly deposited into the data bank. For published sequences the JOURNAL line gives the Thesis, Journal, or Book citation, including the year of publication, the specific citation, or In press. For Book citations, the JOURNAL line is specially-formatted, and includes: editor name(s) book title page number(s) publisher-name/publisher-location year For example: LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003 DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene, partial sequence. ACCESSION AY277550 .... REFERENCE 1 (bases 1 to 1440) AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C. TITLE Classifying bacterial isolates from hypogean environments: Application of a novel fluorimetric method dor the estimation of G+C mol% content in microorganisms by thermal denaturation temperature JOURNAL (in) Saiz-Jimenez,C. (Ed.); MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54; A.A. Balkema, The Netherlands (2003) The presence of "(in)" signals the fact that the reference is for a book rather than a journal article. A semi-colon signals the end of the editor names. The next semi-colon signals the end of the page numbers, and the colon that immediately *precedes* the page numbers signals the end of the book title. The publisher name and location are a free-form text string. Finally, the year appears at the very end of the JOURNAL line, enclosed in parentheses. The MEDLINE line provides the National Library of Medicine's Medline unique identifier for a citation (if known). Medline UIs are 8 digit numbers. The PUBMED line provides the PubMed unique identifier for a citation (if known). PUBMED ids are numeric, and are record identifiers for article abstracts in the PubMed database : http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed Citations in PubMed that do not fall within Medline's scope will have only a PUBMED identifier. Similarly, citations that *are* in Medline's scope but which have not yet been assigned Medline UIs will have only a PUBMED identifier. If a citation is present in both the PubMed and Medline databases, both a MEDLINE and a PUBMED line will be present. The REMARK line is a textual comment that specifies the relevance of the citation to the entry. 3.4.12 FEATURES Format GenBank releases use a feature table format designed jointly by GenBank, the European Nucleotide Archive, and the DNA Data Bank of Japan. This format is in use by all three databases. The most complete and accurate Feature Table documentation can be found on the Web at: http://www.insdc.org/documents/feature-table The feature table contains information about genes and gene products, as well as regions of biological significance reported in the sequence. The feature table contains information on regions of the sequence that code for proteins and RNA molecules. It also enumerates differences between different reports of the same sequence, and provides cross-references to other data collections, as described in more detail below. The first line of the feature table is a header that includes the keyword `FEATURES' and the column header `Location/Qualifiers.' Each feature consists of a descriptor line containing a feature key and a location (see sections below for details). If the location does not fit on this line, a continuation line may follow. If further information about the feature is required, one or more lines containing feature qualifiers may follow the descriptor line. The feature key begins in column 6 and may be no more than 15 characters in length. The location begins in column 22. Feature qualifiers begin on subsequent lines at column 22. Location, qualifier, and continuation lines may extend from column 22 to 80. Feature tables are required, due to the mandatory presence of the source feature. The sections below provide a brief introduction to the feature table format. 3.4.12.1 Feature Key Names The first column of the feature descriptor line contains the feature key. It starts at column 6 and can continue to column 20. The list of valid feature keys is available at: http://www.insdc.org/documents/feature-table#7.2 3.4.12.2 Feature Location The second column of the feature descriptor line designates the location of the feature in the sequence. The location descriptor begins at position 22. Several conventions are used to indicate sequence location. Base numbers in location descriptors refer to numbering in the entry, which is not necessarily the same as the numbering scheme used in the published report. The first base in the presented sequence is numbered base 1. Sequences are presented in the 5' to 3' direction. Location descriptors can be one of the following: 1. A single base; 2. A contiguous span of bases; 3. A site between two bases; 4. A single base chosen from a range of bases; 5. A single base chosen from among two or more specified bases; 6. A joining of sequence spans; 7. A reference to an entry other than the one to which the feature belongs (i.e., a remote entry), followed by a location descriptor referring to the remote sequence; A site between two residues, such as an endonuclease cleavage site, is indicated by listing the two bases separated by a carat (e.g., 23^24). A single residue chosen from a range of residues is indicated by the number of the first and last bases in the range separated by a single period (e.g., 23.79). The symbols < and > indicate that the end point of the range is beyond the specified base number. A contiguous span of bases is indicated by the number of the first and last bases in the range separated by two periods (e.g., 23..79). The symbols < and > indicate that the end point of the range is beyond the specified base number. Starting and ending positions can be indicated by base number or by one of the operators described below. Operators are prefixes that specify what must be done to the indicated sequence to locate the feature. The following are the operators available, along with their most common format and a description. complement (location): The feature is complementary to the location indicated. Complementary strands are read 5' to 3'. join (location, location, .. location): The indicated elements should be placed end to end to form one contiguous sequence. order (location, location, .. location): The elements are found in the specified order in the 5 to 3 direction, but nothing is implied about the rationality of joining them. 3.4.12.3 Feature Qualifiers Qualifiers provide additional information about features. They take the form of a slash (/) followed by a qualifier name and, if applicable, an equal sign (=) and a qualifier value. Feature qualifiers begin at column 22. The list of valid feature keys is available at: http://www.insdc.org/documents/feature-table#7.3 Qualifiers convey many types of information. Their values can, therefore, take several forms: 1. Free text; 2. Controlled vocabulary or enumerated values; 3. Citations or reference numbers; 4. Sequences; Text qualifier values must be enclosed in double quotation marks. The text can consist of any printable characters (ASCII values 32-126 decimal). If the text string includes double quotation marks, each set must be `escaped' by placing a double quotation mark in front of it (e.g., /note="This is an example of ""escaped"" quotation marks"). Some qualifiers require values selected from a limited set of choices. For example, as of June 2022 the `/exception' qualifier has only four allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement required for product', and 'annotated by transcript or proteomic data'. These are known as controlled vocabulary qualifier values. Controlled qualifier values are case sensitive. Citation or published reference numbers for the entry should be enclosed in square brackets ([]) to distinguish them from other numbers. A literal sequence of bases (e.g., "atgcatt") should be enclosed in quotation marks. Literal sequences are distinguished from free text by context. Qualifiers that take free text as their values do not take literal sequences, and vice versa. 3.4.12.4 Cross-Reference Information One type of information in the feature table lists cross-references to the annual compilation of transfer RNA sequences in Nucleic Acids Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl. Each tRNA entry of the feature table contains a /note= qualifier that includes a reference such as `(NAR: 1234)' to identify code 1234 in the NAR compilation. When such a cross-reference appears in an entry that contains a gene coding for a transfer RNA molecule, it refers to the code in the tRNA gene compilation. Similar cross-references in entries containing mature transfer RNA sequences refer to the companion compilation of tRNA sequences published by D.H. Gauss and M. Sprinzl in Nucleic Acids Research. 3.4.12.5 Feature Table Examples In the first example a number of key names, feature locations, and qualifiers are illustrated, taken from different sequences. The first table entry is a coding region consisting of a simple span of bases and including a /gene qualifier. In the second table entry, an NAR cross-reference is given (see the previous section for a discussion of these cross-references). The third and fourth table entries use the symbols `<`and `>' to indicate that the beginning or end of the feature is beyond the range of the presented sequence. In the fifth table entry, the symbol `^' indicates that the feature is between bases. 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- CDS 5..1261 /product="alpha-1-antitrypsin precursor" /map="14q32.1" /gene="PI" tRNA 1..87 /note="Leu-tRNA-CAA (NAR: 1057)" /anticodon=(pos:35..37,aa:Leu) mRNA 1..>66 /note="alpha-1-acid glycoprotein mRNA" transposon <1..267 /note="insertion element IS5" misc_recomb 105^106 /note="B.subtilis DNA end/IS5 DNA start" conflict 258 /replace="t" /citation=[2] ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 10. Feature Table Entries The next example shows the representation for a CDS annotated on a scaffold/ CON-division entry built from contigs of the LQNL01 WGS project: 1 10 20 30 40 50 60 70 79 ---------+---------+---------+---------+---------+---------+---------+--------- LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017 DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold O_flexuosa-1.0_Cont1703, whole genome shotgun sequence. ACCESSION KZ271580 LQNL01000000 VERSION KZ271580.1 DBLINK BioProject: PRJNA230512 BioSample: SAMN04226856 KEYWORDS WGS; HIGH_QUALITY_DRAFT. ... mRNA complement(join(<1..1557,1914..2102,2273..2312)) /locus_tag="X798_08235" /product="hypothetical protein" CDS complement(join(<1..1557,1914..2102,2273..2312)) /locus_tag="X798_08235" /codon_start=1 /product="hypothetical protein" /protein_id="OZC04795.1" /db_xref="GI:1233056989" /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK IVEIPTEIPVEEVLEEKPIVTAKIITGLF" CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586, gap(100),LQNL01005324.1:1..24917) // ---------+---------+---------+---------+---------+---------+---------+--------- 1 10 20 30 40 50 60 70 79 Example 11. Scaffold/CON-division join() sequence 3.4.13 ORIGIN Format The ORIGIN record may be left blank, may appear as `Unreported.' or may give a local pointer to the sequence start, usually involving an experimentally determined restriction cleavage site or the genetic locus (if available). The ORIGIN record ends in a period if it contains data, but does not include the period if the record is left empty (in contrast to the KEYWORDS field which contains a period rather than being left blank). 3.4.14 SEQUENCE Format The nucleotide sequence for an entry is found in the records following the ORIGIN record. The sequence is reported in the 5' to 3' direction. There are sixty bases per record, listed in groups of ten bases followed by a blank, starting at position 11 of each record. The number of the first nucleotide in the record is given in columns 4 to 9 (right justified) of the record. 3.4.15 CONTIG Format As an alternative to SEQUENCE, a CONTIG record can be present following the ORIGIN record. A join() statement utilizing a syntax similar to that of feature locations (see the Feature Table specification mentioned in Section 3.4.12) provides the accession numbers and basepair ranges of other GenBank sequences which contribute to a large-scale biological object, such as a chromosome or complete genome. Here is an example of the use of CONTIG : CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076, AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696, AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641, [ lines removed for brevity ] AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856) However, the CONTIG join() statement can also utilize a special operator which is *not* part of the syntax for feature locations: gap() : Gap of unknown length. gap(X) : Gap with an estimated integer length of X bases. To be represented as a run of n's of length X in the sequence that can be constructed from the CONTIG line join() statement . gap(unkX) : Gap of unknown length, which is to be represented as an integer number (X) of n's in the sequence that can be constructed from the CONTIG line join() statement. The value of this gap operator consists of the literal characters 'unk', followed by an integer. Here is an example of a CONTIG line join() that utilizes the gap() operator: CONTIG join(complement(AADE01002756.1:1..10234),gap(1206), AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633), AADE01005641.1:1..2377) The first and last elements of the join() statement may be a gap() operator. But if so, then those gaps should represent telomeres, centromeres, etc. Consecutive gap() operators are illegal. 4. ALTERNATE RELEASES NCBI is supplying sequence data in the GenBank flat file format to maintain compatibility with existing software which require that particular format. Although we have made every effort to ensure that these data are presented in the traditional flat file format, if you encounter any problems in using these data with software which is based upon the flat file format, please contact us at: info@ncbi.nlm.nih.gov The flat file is just one of many possible report formats that can be generated from the richer representation supported by the ASN.1 form of the data. Developers of new software tools should consider using the ASN.1 form directly to take advantage of those features. Documentation and a Software Developer's Toolkit for ASN.1 are available through NCBI. The Software Developer's Toolkit and PostScript documentation for Linux, MacOS and Microsoft Windows systems is available in a compressed UNIX tar file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++ directory. The file is 'ncbi_cxx--18_0_0.tar.gz'. 5. KNOWN PROBLEMS OF THE GENBANK DATABASE 5.1 Incorrect Gene Symbols in Entries and Index The /gene qualifier for many GenBank entries contains values other than the official gene symbol, such as the product or the standard name of the gene. 6. GENBANK ADMINISTRATION The National Center for Biotechnology Information (NCBI), National Library of Medicine, National Institutes of Health, is responsible for the production and distribution of the NIH GenBank Sequence Database. NCBI distributes GenBank sequence data by anonymous FTP, e-mail servers and other network services. For more information, you may contact NCBI at the e-mail address: info@ncbi.nlm.nih.gov . 6.1 Registered Trademark Notice GenBank (R) is a registered trademark of the U.S. Department of Health and Human Services for the Genetic Sequence Data Bank. 6.2 Citing GenBank If you have used GenBank in your research, we would appreciate it if you would include a reference to GenBank in all publications related to that research. When citing data in GenBank, it is appropriate to provide the primary accession number for a sequence and the publication in which the sequence first appeared. If the data are unpublished, we urge you to contact the group which submitted the data to GenBank to see if there is a recent publication or if they have determined any revisions or extensions of the data. It is also appropriate to list a reference for GenBank itself. The following publication, which describes the GenBank database, should be cited: Sayers EW, Cavanaugh M, Frisse L, Pruitt KD, Schneider VA, Underwood BA, Yankie L, Karsch-Mizrachi I, "GenBank 2025 update", Nucleic Acids Research, Volume 53, Issue D1, January 2025, pp. D56-D61. PMID: 39558184 PMCID: PMC11701615 DOI: 10.1093/nar/gkae1114 The following statement is an example of how one might cite GenBank data. It cites the sequence, its primary accession number, the group who determined the sequence, and GenBank. The numbers in parentheses refer to the GenBank citation above and to the REFERENCE in the GenBank sequence entry. `We scanned the GenBank (1) database for sequence similarities and found one sequence (2), GenBank accession number V00002, which showed significant similarity to...' (1) Sayers, EW. et al, Nucleic Acids Res. 53(D1):D56-D612 (2025) (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982) 6.3 GenBank Distribution Formats and Media Complete flat file releases of the GenBank database are available via NCBI's anonymous ftp server: https://ftp.ncbi.nih.gov Each release is cumulative, incorporating all previous GenBank data. No retrieval software is provided. GenBank distribution via CD-ROM ceased as of GenBank Release 106.0 (April, 1998). 6.4 Other Methods of Accessing GenBank Data Entrez is a molecular biology database system that presents an integrated view of DNA and protein sequence data, 3D structure data, complete genomes, and associated PubMed articles. The system is produced by the National Center for Biotechnology Information (NCBI), and is available only via the Internet (using the Web-Entrez and Network-Entrez applications). Accessing Entrez is easy: Simply direct your web browser of choice to: http://www.ncbi.nlm.nih.gov/ The Web version of Entrez has all the capabilities of the network version, but with the visual style of the World Wide Web. If you prefer the "look and feel" of Network-Entrez, you may download Network-Entrez from the NCBI's FTP server: https://ftp.ncbi.nih.gov/ Versions are available for PC/Windows, Macintosh and several Unix variants. For information about Network-Entrez, Web-Entrez or any other NCBI services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov . 6.5 Request for Corrections and Comments We welcome your suggestions for improvements to GenBank. We are especially interested to learn of errors or inconsistencies in the data. BankIt or Genome Workbench can be used to submit revisions to previous submissions. In addition, suggestions and corrections can be sent by electronic mail to: update@ncbi.nlm.nih.gov. Please be certain to indicate the primary accession number of the entry to which your comments apply; it is helpful if you also give the entry name and the current contents of any data field for which you are recommending a change. 6.6 Credits and Acknowledgments Credits - GenBank Submission Coordination Ilene Mizrachi GenBank Annotation Staff Michael Baxter, Shelby Bidwell, Larissa Brown, Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky, Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse, Andrea Gocke, Anjanette Johnston, Erica Lam, Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi, DeAnne Olsen Cravaritis, Susan Schafer, Augustus Tilley, Beverly Underwood, and Linda Yankie GenBank Release Coordination Liwei Zhou Data Management and Preparation Serge Bazhin, Evgueni Belyi, Colleen Bollin, Yoon Choi, Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov, Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans, Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh, Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov, Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov, Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko, Hanzhen Sun, Richard McVeigh, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou Database Administration Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov, Benjamin Slade, Constantin Vasilyev Customer Support David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers, Majda Valjavec-Gratian Project Direction/Leadership Steve Sherry : Acting Director, NLM Kim Pruitt : Acting Director, NCBI Valerie Schneider : Acting Branch Chief, NCBI/IEB Eugene Yaschenko : Chief Technology Officer, NCBI/IRB Acknowledgments - Contractor support for GenBank production and distribution has been provided by Management Systems Designers, Inc., ComputerCraft Corporation, and The KEVRIC Company, Inc. 6.7 Disclaimer The United States Government makes no representations or warranties regarding the content or accuracy of the information. The United States Government also makes no representations or warranties of merchantability or fitness for a particular purpose or that the use of the sequences will not infringe any patent, copyright, trademark, or other rights. The United States Government accepts no responsibility for any consequence of the receipt or use of the information. For additional information about GenBank releases, please contact NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at: GenBank National Library of Medicine Bldg. 38A Rm. 8N-809 8600 Rockville Pike