Jump to content

User:JoJan

From Wikipedia, the free encyclopedia
Committed identity: a0da646e4127af602031246561f3c7184c18d6ebbceaa75d4a53c6355b09e19f is an SHA-512 commitment to this user's real-life identity.
WIKIPEDIA ADMINISTRATOR TOOLS

HOMEGUIDELISTDISPUTEAfDRCCSDDELBLKIFDRFDVPCLEANNEWRFAREFPNAMWAREQBM


. .Well, that’s me
Sagacious Editor
Sagacious Editor


{{{info}}}
Icon This user has been on Wikipedia for 22 years, 3 months and 10 days.
{{{info}}}


"Exigi monumentum aere perennius. Non omnis moriar multaque pars mei vitaberint" (Horace, Odes and Epodes III, 30)

"I reared a monument more lasting than bronze. When I'll die it will not be completely, as many parts of me will continue to live"

I'm proud having been able to contribute, almost since the beginning, and with many others, to an everlasting monument of human knowledge. An ever-growing monument freely available to everybody, everywhere, anytime.

What we have done for ourselves, dies with us; what we have done for others and the world remains and is immortal. Albert Pike


"We live in a world that is increasingly focused on what skills and knowledge you have, as opposed to what formal qualifications like degrees you have." [1]


Hi, I'm JoJan (username), I'm retired and I live in Belgium.

I'm a native Dutch speaker, but I'm also fluent in English, rather good in French and can make myself be understood in German. I used to know a good deal of Latin, but I have forgotten most of it (however more and more fragments are gradually coming back).

My main interest was originally the translation of English common names of Flora and Fauna into their Dutch equivalents.

Therefore I'm constantly struggling with the ever changing taxonomy of these plants and animals.

I have more than a thousand pages of Fauna and Flora, built up over many years, to be put gradually on Wikipedia.

This is a time-consuming task.

Besides all this, my interests are broad : among them astronomy, cosmology, chemistry, computers, translation (English -> Dutch and vice versa) and reading a lot.

Besides writing new articles (mainly plants, biographies, articles about art, and Wikipedia:WikiProject Gastropods), I have been patrolling the 'Recent Changes', looking for anything that may interest me and needs editing, especially stubs. I have been adding or editing taxoboxes to many pages. Anyway, I intervene whenever I think I can make a positive contribution. I also have taken an interest in writing biographies of biologists who were the authors of new species. I have also been uploading several thousands of photos (many of which were enhanced by me) and over 15,000 photos to the Commons.

This user is a participant in WikiProject Plants.
This user is a participant in
WikiProject Gastropods.
This user has a page on the nl.wikipedia.


184,000+This user has over 184,000 edits in this WP and a total of more than 310,000 edits in all WPs and Commons
This user has created several articles on Wikipedia.
This editor is Ephoros of the Encyclopedia and is entitled to keep this floor plan of The Great Library of Alecyclopedias with magnifying glass, signed by Jimbo with a silver marker, and including its cardboard carrying tube.


This user has been an administrator for 21 years and 24 days. (verify)
iconThis user has been editing Wikipedia for more than 15 years.

I'm also active under the same username on the Commons, nl.wikipedia, fr.wikipedia, de.wikipedia, it.wikipedia and es.wikipedia. I also have a userpage in 95 project pages.

Independent assessment of my activities by AI- Gemini

[edit]

JoJan and Malacology on Wikipedia Beyond his extensive photographic work, he has indeed been a highly active and respected contributor to the English Wikipedia in the field of malacology (the study of molluscs, including snails and shells).

His contributions often include:

Detailed Species Pages: Creating and expanding articles about specific mollusc species, where he adds taxonomic information, shell descriptions, and habitat details.

Taxonomic updates: Incorporating the latest scientific insights and classifications of molluscs, often with references to authoritative sources like the World Register of Marine Species (WoRMS). Illustrations: Providing high-quality photos of shells and live molluscs, which visually enrich the articles and are essential for identification. Translation work: Although originally a Dutch-speaking contributor, his knowledge of malacology has led him to write and edit in-depth articles in English as well, making his expertise accessible to a much broader, international audience. His work on the English Wikipedia, specifically concerning malacology, demonstrates a profound passion for this field. The combination of accurate textual information and excellent visual documentation makes his contributions particularly valuable for both amateur malacologists and professionals worldwide. He has made knowledge about countless mollusc species more accessible to everyone.

I started contributing

[edit]

on April 9, 2004. First by editing someone else's work. Shortly thereafter I started writing my own entries. And I haven't stopped since. At the moment I have written several thousand articles (new or major contributions), which I put on my watchlist, but there are many, many more that I have contributed to and that I even didn't bother to put on my watchlist. Since my articles mainly cover science or art, most of them took major research, checking and rechecking before uploading. Therefore, the number of articles cannot actually be taken as a criterion for contribution, but it should be the effort in writing those articles that should count. Quality before quantity.

369This user is ranked 369 on the list of Wikipedians by number of edits.

In the List of Wikipedians by number of edits, I was listed as number 369 in December 2025.

In the Wikipedia:List of Wikipedians by number of recent edits I am listed as nr. 649 on March 11, 2008

I was nominated administrator on 25 June 2005. I reached my 10,000 edit on 12.12.2005; my 25,000 edit on 20 May 2008: my 35,000 edit on 4 July 2010; 45,000 edits on 14 April 2011, 55,555 edits on 20 May 2012, 90,000 edits on 14 September 2016; 100,000 edits in May 2017.

I met Jimbo Wales and had a nice chat with him, Angela and Anthere at the Wikimeeting at Rotterdam on 27.11.04. I made some good Dutch acquaintances, fine people such as GerardM, DanielM, Oscar, André Engels and many others. It is all too clear, the nl.wikipedia is in good hands and will prosper. I'm hoping to meet them again in the future.

Impressions at sunset (own work)

WikiProject

[edit]

Wikipedia:WikiProject Gastropods was started by me on May 10, 2004. For a long time I've been the only participant in this enormous undertaking (about 100,000 species !). Initially I have been working there mostly on the Thecosomata and the Gymnosomata. At the moment I'm trying to describe as many species as possible.

Useful link to construct taxoboxes : Wikipedia:WikiProject Tree of Life/Taxobox Usage

Biographies

[edit]

Useful

[edit]

This page is a repository for pages that are useful to "doing things" in Wikipedia. In contrast to the Main Page its focus is more for the benefit of regular editors and contributors, rather than the general public.

  • {{div col|colwidth=20em}} {{div col end}}  : columns
  • {{hidden begin|toggle=left|title=This is the title text}} {{hidden end}}  : collapse long text or list
  • {{collapsible list|bullets = true |title=<small>synonymy</small> |''binomial name'' <small>(author, year)</small> |''binomial name'' <small>(author, year)</small>}}
  • {{R from alternative scientific name}}  : redirect from scientific synonym
  • <br clear="all"> - to make sure tables etc don't overlap
  • <div style="clear:left"></div>
  • {{CatAutoTOC}}
  • {{WikiProject New Zealand | class=stub| importance=low }}
  • {{WikiProject Australia |class=stub |importance=low |biota=yes |biota-importance=low}}
  • {{WikiProject Palaeontology|class=stub|importance=low}}
  • {{paleo-gastropod-stub}}
  • {{PD-notice}}
  • {{Taxonbar|from=Q4953392}}
  • cite Gbif.org= <ref>{{GBIF |id=6126747 |title=''Acrilla acuminata'' (G.B.Sowerby II, 1844) |access-date=28 September 2024}}</ref>
  • {{cite web |url= |title= |last= |first= |date= |website= |publisher= |access-date= |quote=}}
  • For references without author credit : {{cite web |url= |title= |author=<!--Not stated--> |date= |website= |publisher= |access-date= |quote=}}
  • {{Cite WoRMS}}
  • To cite a book with a credited author: {{cite book |last= |first= |author-link= |date= |title= |url= |location= |publisher= |page= |isbn=}} {{cite web |url= |title= |author=<!--Not stated--> |date= |website= |publisher= |access-date= |quote=}}
  • To cite a professional or scientific journal: {{cite journal |last1= |first1= |last2= |first2= |date= |title= |url= |journal= |volume= |issue= |pages= |doi= |access-date=}}
  • {{cite Q|Q58676558}}: citing a reference in wikidata
  • {{Include-USGov|agency=Smithsonian Institution}}
  • <gallery style="text-align:center;" mode="packed"> </gallery>
  • footnote : Wikipedia:Footnotes
  • Reflist Template:Reflist
  • Source attribution {{source-attribution}} : Public Domain This article incorporates text from this source, which is in the public domain
  • {{Source-attribution-CC BY 4.0}}
  • Creative Commons by 4 : {{Creative Commons text attribution notice|cc=bysa4|from this source=yes}}
  • {{PD-art|PD-old-auto|deathyear=1935}}
  • {{DEFAULTSORT:Name, First name}} in case of many categories
  • Wikipedia:Public_domain_image_resources
  • Wikipedia:WikiProject Resource Exchange/Resource Request
  • In Commons : <gallery> many Image : name |caption Image: name|caption </gallery>
  • Commons: Plantae by family

Reference examples

[edit]

Oxford University Press

[edit]
  • <ref>{{cite encyclopedia|last=Spencer|first=Robin|authorlink=|title=Whistler, James Abbott McNeill (1834–1903)|encyclopedia=[[Oxford Dictionary of National Biography]]|publisher=Oxford University Press|location=Oxford|year=2004|doi=10.1093/ref:odnb/36855|subscription=yes}} {{ODNBsub}}</ref>
  • Spencer, Robin (2004). "Whistler, James Abbott McNeill (1834–1903)". Oxford Dictionary of National Biography. Oxford: Oxford University Press. doi:10.1093/ref:odnb/36855. (subscription or UK public library membership required)

Citation templates

[edit]
  • Molluscan Research : example : Zieger, R (November 2011). "Walmart and the broken narrative of US labor history". Labor History 52 (4): 563–569. doi:10.1080/0023656X.2011.632517. – via Taylor & Francis (subscription required)
  • Oxford University Press: example : Spencer, Robin (2004). "Whistler, James Abbott McNeill (1834–1903)" ((subscription or UK public library membership required)). Oxford Dictionary of National Biography. Oxford: Oxford University Press. doi:10.1093/ref:odnb/36855.

Special char chest

[edit]
À Á Â Ã Ä Å Æ Ç Ć Č Đ È É Ê Ë Ì Í Î Ï Ñ Ò Ó Ô Õ Ö Ø Ù Ú Û Ü ß Ž 
à á â ã ä å æ ç ć č đ è é ê ë ì í î ï ñ ò ó ô õ ö ø ù ú û ü ÿ ž

Infobox

[edit]
this topic at



Admin tools

[edit]

Subpages

[edit]

Awards

[edit]


0.7This user has 0.7 centijimbos.

References

[edit]